/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 16 Gelatin is processed collagen th... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

Gelatin is processed collagen that comes from the joints of animals. When gelatin is mixed with hot water, the triple helix structure unwinds and the chains separate, becoming random coils that dissolve in the water. As the dissolved gelatin mixture cools, the collagen forms a matrix that traps water; as a result, the mixture turns into the jiggling semisolid mass that is recognizable as Jell- \(\mathrm{O}^{\mathrm{m}}\). The directions on a box of gelatin include the following: "Chill until slightly thickened, then add 1 to 2 cups cooked or raw fruits or vegetables. Fresh or frozen pineapple must be cooked before adding." If the pineapple is not cooked, the gelatin will not set properly. Pineapple belongs to a group of plants called Bromeliads and contains a protease called bromelain. Explain why pineapple must be cooked before adding to gelatin.

Short Answer

Expert verified
Pineapple must be cooked before it is added to gelatin because it contains bromelain, a protease enzyme that breaks down proteins, in this case the collagen from which gelatin is derived. Cooking the pineapple denatures, or deactivates, the bromelain, ensuring it doesn't break down the collagen and allows the gelatin to set properly.

Step by step solution

01

Understanding the behavior of gelatin

Gelatin is processed collagen, a protein, originally structured as a triple helix. When mixed with hot water, the triple helix unwinds, and the chains dissolve into random coils in the water. When the mixture cools, these proteins restructure themselves, creating a matrix that traps water. This is what gives the gelatin its semi-solid, jiggling state.
02

Understanding Bromelain

Pineapple contains a protease called bromelain. A protease is an enzyme that breaks down proteins. In the case of gelatin, the bromelain in pineapple will start breaking down the collagen proteins before they have a chance to form the needed matrix structure.
03

Understanding the role of cooking

Cooking is a process that involves heat. It's important to note that heat can denature proteins, including the bromelain enzyme found in pineapples. So, when pineapple is cooked, the heat denatures, and therefore deactivates, the bromelain enzyme.
04

Concluding why pineapple must be cooked

Once bromelain in pineapple is rendered inactive by heat, it can no longer stop the setting process of gelatin by breaking down the collagen proteins. Thus, the protein matrix can form properly when the mixture cools, enabling the gelatin to set correctly. Hence, pineapple must be cooked before adding to gelatin.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Collagen Structure
Collagen is a vital protein found abundantly in the connective tissues of animals. It plays a crucial role in maintaining structural integrity. Collagen's structure is unique; it is formed by three polypeptide chains that twist around each other to create a sturdy triple helix. This helix is a highly organized and stable structure, contributing to collagen's strength. When it is heated, like in the process of making gelatin, the triple helix unwinds.

The unwinding of the collagen's triple helix leads to the formation of individual chains or strands. These chains are highly flexible and become random coils in hot water. As the gelatin solution cools, these coils start interacting, forming a mesh-like matrix.

This matrix traps water, resulting in the familiar semisolid and jiggly texture of gelatin. Understanding the collagen structure is key to grasping how gelatin functions and why it sets only under certain conditions.
Proteolytic Enzymes
Proteolytic enzymes, also known as proteases, are specialized proteins that break down other proteins into smaller peptides or amino acids. They are vital in numerous biological processes, including digestion and protein recycling.

Pineapple contains a specific protease known as bromelain. Bromelain is especially adept at cleaving proteins apart, making it useful in meat tenderizing and enzyme therapies. However, in the context of gelatin, bromelain's active protein-cleaving action can interfere with the setting process.

When fresh pineapple is added to gelatin, bromelain snips away at the collagen strands before they can form a cohesive network. Consequently, the gelatin does not solidify properly as the protein matrix is compromised by the enzyme's activity.

To prevent this, it’s crucial to deactivate bromelain through cooking, which leads us to explanations of protein denaturation.
Protein Denaturation
Protein denaturation is the process where a protein loses its native structure due to external stress, such as heat, acid, or mechanical force. This often results in the loss of protein function.

Cooking the pineapple is a practical application of protein denaturation. The heat applied during cooking disrupts the structure of bromelain, causing it to unravel and inactivate. Denatured bromelain can't cleave collagen strands, allowing the gelatin to set properly upon cooling.

Just as with collagen, understanding denaturation helps explain many biochemical processes. It shows how heat transforms enzymes and impacts their functionality. By cooking pineapple, you nullify bromelain’s proteolytic action, thereby ensuring your gelatin dessert holds its shape.

Thus, denaturation is not merely a scientific phenomenon but a tool we can use in everyday cooking to achieve desired results.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

The larval form of the parasite Schistosoma mansoni infects humans by penetrating the skin. The larva secretes enzymes that catalyze the cleavage of peptide bonds between residues \(\mathrm{X}\) and \(\mathrm{Y}\) in the sequence -Gly-Pro-X-Y- \((X\) and \(Y\) can be any of several amino acids). Why is this enzyme activity important for the parasite?

(a) Characterize the hydrogen-bonding pattern of (1) an \(\alpha\) helix and \((2)\) a collagen triple helix. (b) Explain how the amino acid side chains are arranged in each of these helices.

The spider venom from the Chilean Rose Tarantula (Grammostola spatulata) contains a toxin that is a 34 -amino acid protein. It is thought to be a globular protein that partitions into the lipid membrane to exert its effect. The sequence of the protein is: ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF (a) Identify the hydrophobic and highly hydrophilic amino acids in the protein. (b) The protein is thought to have a hydrophobic face that interacts with the lipid membrane. How can the hydrophobic amino acids far apart in sequence interact to form a hydrophobic face? [Adapted from Lee, S. and MacKinnon, R. (2004). Nature 430: 232-235.]

Fetal hemoglobin (Hb F) contains serine in place of the cationic histidine at position 143 of the \(\beta\) chains of adult hemoglobin (Hb \(\mathrm{A}\) ). Residue 143 faces the central cavity between the \(\beta\) chains. (a) Why does \(2,3 \mathrm{BPG}\) bind more tightly to deoxy Hb A than to deoxy Hb F? (b) How does the decreased affinity of \(\mathrm{Hb} \mathrm{F}\) for \(2,3 \mathrm{BPG}\) affect the affinity of \(\mathrm{Hb} \mathrm{F}\) for \(\mathrm{O}_{2}\) ? (c) The \(\mathrm{P}_{50}\) for \(\mathrm{Hb} \mathrm{F}\) is 18 torr, and the \(P_{50}\) for \(\mathrm{Hb} \mathrm{A}\) is 26 torr. How do these values explain the efficient transfer of oxygen from maternal blood to the fetus?

Explain why (1) glycine and (2) proline residues are not commonly found in \(\alpha\) helices.

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.