/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 11 (a) How does the reaction of car... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

(a) How does the reaction of carbon dioxide with water help explain the Bohr effect? Include the equation for the formation of bicarbonate ion from \(\mathrm{CO}_{2}\) and water, and explain the effects of \(\mathrm{H}^{\oplus}\) and \(\mathrm{CO}_{2}\) on hemoglobin oxygenation. (b) Explain the physiological basis for the intravenous administration of bicarbonate to shock victims.

Short Answer

Expert verified
The reaction of CO2 with water creating bicarbonate ion and a proton helps explain the Bohr effect: an increased \(\mathrm{H}^{\oplus}\) or an increased \(\mathrm{CO}_{2}\) concentration leads to less oxygen binding to hemoglobin. Physiologically, bicarbonate is administered to shock victims to neutralize acidosis, as it acts as a buffer to absorb the excess protons, which raises the blood pH.

Step by step solution

01

Bohr Effect Explanation

The Bohr effect explains how carbon dioxide and acid concentration, i.e. increased \(\mathrm{H}^{\oplus}\) concentration, influence oxygen binding to hemoglobin. In areas where there is high \(\mathrm{CO}_{2}\) or \(\mathrm{H}^{\oplus}\), oxygen binding to hemoglobin is reduced - an effect known as oxygen off-loading
02

Reaction of Carbon Dioxide and Water

When carbon dioxide combines with water, it results in carbonic acid which further dissociates into bicarbonate ion and a proton: \(\mathrm{CO}_{2}\) + \(H_{2}O\) <-> \(H_{2}CO_{3}\) <-> \(HCO_{3}^{-}\) + \(\mathrm{H}^{\oplus}\)
03

Effects of H+ and CO2 on Hemoglobin Oxygenation

High concentration of protons makes the environment acidic which favours the taut (T) state of hemoglobin, this low-affinity state enhances the release of oxygen. Similarly, CO2 directly binds to hemoglobin to form carbaminohemoglobin, promoting a conformational change that enhances the release of oxygen too.
04

Physiological Basis for Bicarbonate Administration

In part (b), bicarbonate is administered in cases of shock due to its ability to treat metabolic acidosis, a condition commonly associated with shock. The bicarbonate ion acts as a buffer that can take up the excess protons, thus neutralizing the acid and increasing the blood pH.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Carbon Dioxide Reaction
When carbon dioxide (\(\text{CO}_2\)) enters the blood, it reacts with water (\(H_2O\)) to form carbonic acid (\(H_2CO_3\)), which quickly dissociates into bicarbonate (\(HCO_3^-\)) and a hydrogen ion (\(\text{H}^+\)). This can be represented by the equation:
  • \[\text{CO}_2 + H_2O \leftrightarrow H_2CO_3 \leftrightarrow HCO_3^- + \text{H}^+\]
This reaction plays a crucial role in the Bohr Effect by influencing blood pH and affecting oxygen binding to hemoglobin.
This process is reversible, allowing it to adapt to different conditions, helping maintain balance in the body. The formation of the bicarbonate ion is vital as it acts as a buffer, helping to stabilize blood pH by neutralizing excess acids or bases.
Hemoglobin Oxygenation
Hemoglobin, the molecule in red blood cells responsible for transporting oxygen, undergoes changes based on the concentration of \(\text{CO}_2\) and \(\text{H}^+\) ions. The Bohr Effect describes how these factors reduce hemoglobin's affinity for oxygen, leading to oxygen off-loading where it's needed most.
In high \(\text{CO}_2\) areas, carbon dioxide binds directly to hemoglobin to form carbaminohemoglobin, promoting the release of oxygen. Simultaneously, an acidic environment (high \(\text{H}^+\) concentration) stabilizes the T state of hemoglobin, which is a low-affinity state, further encouraging oxygen release.
This adaptability allows hemoglobin to release oxygen efficiently depending on the body's current requirements, especially during high metabolic activity.
Bicarbonate Administration
In medical emergencies like shock, bicarbonate is sometimes administered to address metabolic acidosis. This occurs when the body produces too much acid or when the kidneys cannot remove enough acid from the body.
Bicarbonate ions (\(HCO_3^-\)) function as a buffer, interacting with excess \(\text{H}^+\) ions to form carbonic acid, which further dissociates to \(\text{CO}_2\) and water, thus raising blood pH levels. This response helps stabilize a victim’s condition by balancing pH levels, vital for proper cellular function.
  • Improves oxygen transport by stabilizing blood pH
  • Helps maintain metabolic processes
This swift action can be life-saving by allowing the body’s systems to function optimally even in critical states.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

Explain why (1) glycine and (2) proline residues are not commonly found in \(\alpha\) helices.

Amino acid substitutions at the \(\alpha \beta\) subunit interfaces of hemoglobin may interfere with the \(R \rightleftharpoons T\) quaternary structural changes that take place on oxygen binding. In the hemoglobin variant \(\mathrm{Hb}_{\text {Yakima }}\), the \(\mathrm{R}\) form is stabilized relative to the \(\mathrm{T}\) form, and \(P_{50}=12\) torr. Explain why the mutant hemoglobin is less efficient than normal hemoglobin \(\left(P_{50}=26\right.\) torr \()\) in delivering oxygen to working muscle, where \(\mathrm{O}_{2}\) may be as low as 10 to 20 torr.

(a) Characterize the hydrogen-bonding pattern of (1) an \(\alpha\) helix and \((2)\) a collagen triple helix. (b) Explain how the amino acid side chains are arranged in each of these helices.

The spider venom from the Chilean Rose Tarantula (Grammostola spatulata) contains a toxin that is a 34 -amino acid protein. It is thought to be a globular protein that partitions into the lipid membrane to exert its effect. The sequence of the protein is: ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF (a) Identify the hydrophobic and highly hydrophilic amino acids in the protein. (b) The protein is thought to have a hydrophobic face that interacts with the lipid membrane. How can the hydrophobic amino acids far apart in sequence interact to form a hydrophobic face? [Adapted from Lee, S. and MacKinnon, R. (2004). Nature 430: 232-235.]

Fetal hemoglobin (Hb F) contains serine in place of the cationic histidine at position 143 of the \(\beta\) chains of adult hemoglobin (Hb \(\mathrm{A}\) ). Residue 143 faces the central cavity between the \(\beta\) chains. (a) Why does \(2,3 \mathrm{BPG}\) bind more tightly to deoxy Hb A than to deoxy Hb F? (b) How does the decreased affinity of \(\mathrm{Hb} \mathrm{F}\) for \(2,3 \mathrm{BPG}\) affect the affinity of \(\mathrm{Hb} \mathrm{F}\) for \(\mathrm{O}_{2}\) ? (c) The \(\mathrm{P}_{50}\) for \(\mathrm{Hb} \mathrm{F}\) is 18 torr, and the \(P_{50}\) for \(\mathrm{Hb} \mathrm{A}\) is 26 torr. How do these values explain the efficient transfer of oxygen from maternal blood to the fetus?

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.