/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 12 Fetal hemoglobin (Hb F) contains... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

Fetal hemoglobin (Hb F) contains serine in place of the cationic histidine at position 143 of the \(\beta\) chains of adult hemoglobin (Hb \(\mathrm{A}\) ). Residue 143 faces the central cavity between the \(\beta\) chains. (a) Why does \(2,3 \mathrm{BPG}\) bind more tightly to deoxy Hb A than to deoxy Hb F? (b) How does the decreased affinity of \(\mathrm{Hb} \mathrm{F}\) for \(2,3 \mathrm{BPG}\) affect the affinity of \(\mathrm{Hb} \mathrm{F}\) for \(\mathrm{O}_{2}\) ? (c) The \(\mathrm{P}_{50}\) for \(\mathrm{Hb} \mathrm{F}\) is 18 torr, and the \(P_{50}\) for \(\mathrm{Hb} \mathrm{A}\) is 26 torr. How do these values explain the efficient transfer of oxygen from maternal blood to the fetus?

Short Answer

Expert verified
2,3-BPG binds more tightly to Hb A than to Hb F due to the positively charged histidine at position 143, forming stronger electrostatic interactions with the negatively charged 2,3 BPG. The weaker binding in Hb F increases its O2 affinity. The lower P50 value of Hb F ensures efficient O2 transfer from maternal blood to the fetus.

Step by step solution

01

Understanding the structural difference

First, let's take a closer look at the structural difference between Hb A and Hb F. The primary distinction lies in the β-chain residue at position 143. In adult hemoglobin (Hb A), this position is occupied by histidine, a positively charged, or cationic, amino acid. However, in fetal hemoglobin (Hb F), this position is filled by serine, an uncharged polar amino acid.
02

Binding of 2,3 BPG to Hb

2,3 BPG is a molecule that can bind to hemoglobin, and more tightly to deoxyhemoglobin (Hb without O2) than to oxygenated hemoglobin (Hb with O2). It binds within the central cavity created by the β chains in Hb A. Due to the positive charge of the histidine residue at position 143, it forms electrostatic interactions with the negatively charged 2,3 BPG. As serine is uncharged, the interaction with 2,3 BPG is weaker in Hb F, leading to looser binding.
03

Affinities of Hb F and Hb A for O2

The decreased affinity of Hb F for 2,3 BPG increases its affinity for O2 compared to Hb A. This is because 2,3 BPG acts as an allosteric effector that lowers the O2 affinity of hemoglobin. Therefore, Hb F's lower affinity for 2,3 BPG mans it opperates in a higher loading state for O2 under equivalent conditions.
04

Explaining P50 values

P50 is a measure of the partial pressure of O2 required to saturate 50% of hemoglobin. A lower P50 value signifies greater affinity for O2. As stated, Hb F has a lower P50 value, hence a higher affinity for O2, facilitating its role in transporting O2 from the mother (who has Hb A) to the fetus (with Hb F). The efficient transfer of O2 from maternal blood to fetus ensures the fetus receives adequate O2 for its development.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

2,3 BPG binding
Fetal hemoglobin (Hb F) and adult hemoglobin (Hb A) differ in their affinity for a molecule called 2,3-bisphosphoglycerate (2,3 BPG). This molecule plays a key role in regulating hemoglobin's ability to bind and release oxygen.

In Hb A, 2,3 BPG binds tightly because of the positive charge on the histidine residue at position 143 in the \( \beta \) chain. This positive charge encourages electrostatic interactions with the negatively charged 2,3 BPG, stabilizing the deoxygenated form of hemoglobin.

Conversely, fetal hemoglobin (Hb F) has serine at this position, which is uncharged. This leads to weaker binding of 2,3 BPG because there's no strong electrostatic interaction to stabilize the bond.
Consequently, this weaker interaction influences how Hb F manages oxygen, affecting its overall function in the fetus.
Oxygen affinity
Oxygen affinity is a crucial concept that influences how effectively hemoglobin can carry oxygen throughout the body. In the context of fetal hemoglobin, the weaker binding to 2,3 BPG increases its affinity for oxygen.

This is because 2,3 BPG normally decreases hemoglobin's oxygen affinity by stabilizing the deoxy form of hemoglobin.

When 2,3 BPG binds less tightly, as seen in fetal hemoglobin, hemoglobin keeps a higher propensity to capture and hold onto oxygen molecules, especially under the same conditions compared to adult hemoglobin.

This increased affinity means that fetal hemoglobin is better suited for binding oxygen, even at lower concentrations, a crucial adaptation for fetal development inside the womb where oxygen levels can be lower compared to outside.
P50 values
P50 values provide an essential measure of oxygen affinity. Specifically, P50 refers to the partial pressure of oxygen needed to saturate 50% of hemoglobin.

When comparing fetal hemoglobin (Hb F) and adult hemoglobin (Hb A), Hb F has a lower P50 value at 18 torr, compared to Hb A, which sits at 26 torr.

The lower P50 value of Hb F means it has a higher affinity for oxygen. In simpler terms, less oxygen is needed to achieve half saturation on Hb F compared to Hb A.
This difference in P50 values between fetal and adult hemoglobin directly influences the efficiency of oxygen transfer from mother to fetus, highlighting the biological importance of these differences in P50.
Fetal and maternal blood oxygen transfer
The process of transferring oxygen from maternal blood to fetal blood is life-supporting and involves the strategic differences between fetal and maternal hemoglobin.
  • Fetal hemoglobin (Hb F) with higher oxygen affinity ensures that it can take up oxygen efficiently from maternal hemoglobin (Hb A).
  • The lower P50 of fetal hemoglobin allows the fetus to extract oxygen from the maternal blood effectively, even when the oxygen levels are not at peak levels.

This fine-tuned biological mechanism ensures that fetal tissues receive adequate oxygen for development, despite potential limitations on the amount of available oxygen. By taking advantage of these hemoglobin differences, the fetus is well adapted to thrive in the environment of a mother's womb, paving the way for healthy growth and development.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

Myoglobin contains eight \(\alpha\) helices, one of which has the following sequence: $$ \text { -Gln-Gly-Ala-Met-Asn-Lys-Ala-Leu–Glu-His-Phe-Arg-Lys- } $$ $$ \text { Asp-Ile-Ala-Ala- } $$ Which side chains are likely to be on the side of the helix that faces the interior of the protein? Which are likely to be facing the aqueous solvent? Account for the spacing of the residues facing the interior.

The spider venom from the Chilean Rose Tarantula (Grammostola spatulata) contains a toxin that is a 34 -amino acid protein. It is thought to be a globular protein that partitions into the lipid membrane to exert its effect. The sequence of the protein is: ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF (a) Identify the hydrophobic and highly hydrophilic amino acids in the protein. (b) The protein is thought to have a hydrophobic face that interacts with the lipid membrane. How can the hydrophobic amino acids far apart in sequence interact to form a hydrophobic face? [Adapted from Lee, S. and MacKinnon, R. (2004). Nature 430: 232-235.]

The larval form of the parasite Schistosoma mansoni infects humans by penetrating the skin. The larva secretes enzymes that catalyze the cleavage of peptide bonds between residues \(\mathrm{X}\) and \(\mathrm{Y}\) in the sequence -Gly-Pro-X-Y- \((X\) and \(Y\) can be any of several amino acids). Why is this enzyme activity important for the parasite?

(a) Characterize the hydrogen-bonding pattern of (1) an \(\alpha\) helix and \((2)\) a collagen triple helix. (b) Explain how the amino acid side chains are arranged in each of these helices.

Explain why (1) glycine and (2) proline residues are not commonly found in \(\alpha\) helices.

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.