/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 3 Explain why (1) glycine and (2) ... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

Explain why (1) glycine and (2) proline residues are not commonly found in \(\alpha\) helices.

Short Answer

Expert verified
Glycine is not commonly found in \(\alpha\) helices because it is too flexible as a result of its small size, making it hard to fit in the relatively rigid helical structure. Proline is not commonly found because its unique ring structure restricts the rotation around the N-C bond and lacks the necessary amide hydrogen for forming hydrogen bonds, making it incompatible with the \(\alpha\) helix structure.

Step by step solution

01

Understand the properties of Glycine

Glycine is the simplest amino acid with a hydrogen as its side chain. This small size allows for a great deal of flexibility. In an \(\alpha\) helix structure, each amino acid has to tightly pack with the others, which requires a certain level of rigidity. Glycine's flexibility makes it less likely to fit into the relatively rigid structure of an \(\alpha\) helix, and therefore it is not commonly found in \(\alpha\) helices.
02

Understand the properties of Proline

Proline is unique among the 20 standard amino acids because its side chain forms a ring structure with the backbone nitrogen, making it a secondary amine. This rigid structure imposes constraints on the angle of rotation around the nitrogen-carbonyl carbon (N-C) bond, making it incompatible with the helical structure. Furthermore, proline lacks the amide hydrogen necessary for the formation of hydrogen bonds, which are important in maintaining the stability of the \(\alpha\) helix structure.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Glycine Properties and Flexibility
Glycine is one of the simplest amino acids found in proteins. It stands out because its side chain is just a single hydrogen atom. This unique characteristic makes glycine incredibly flexible. It can easily adapt to a variety of structural contexts in proteins. Since it is small and can rotate freely, glycine does not fit well into the alpha helix structure.

The alpha helix is a common motif in the secondary structure of proteins, where each amino acid needs to sustain a certain degree of rigidity to pack closely together. Because glycine is so flexible, it often disrupts the regularity and stability of an alpha helix, which depends on successive amino acids interacting through hydrogen bonds. This is why glycine is rarely found in alpha helices.
  • Glycine is tiny and very flexible.
  • It lacks the side chain volume required for the tight packing in helices.
  • Glycine's flexibility prevents it from fitting well into the alpha helix structure.
Proline Structure and Rigidity
Unlike glycine, proline introduces significant rigidity into protein structures. Its side chain forms a cyclic structure by bonding back to the backbone nitrogen, making it a secondary amine. This ring severely restricts rotation along the polypeptide chain. Such constraints mean that proline cannot adopt the angles typically required for forming an alpha helix.

Alpha helices require precise bonding and alignment of each amino acid, but proline's rigidity prevents it from aligning properly within this tight structure. Additionally, proline lacks the amide hydrogen necessary for the sequence of hydrogen bonds that stabilize alpha helices. Hence, its presence often results in a kink or break within the alpha helix.
  • Proline's unique ring structure limits rotational freedom.
  • It disrupts alpha helix formation by preventing necessary hydrogen bonding.
  • Proline’s rigidity introduces breaks in the helix.
Amino Acid Contribution to Protein Folding
Amino acids are the building blocks of proteins, and their distinct properties significantly influence protein folding. Each amino acid's side chain affects how it contributes to the structure and function of the protein. This contributes to the diversity and complexity of protein structures, such as alpha helices, beta sheets, and random coils.

The interactions and conformational tendencies of amino acids are crucial in protein folding. For instance, the flexibility of glycine allows it to be present in regions that require turns or bends. Meanwhile, proline, with its rigid nature, can introduce interruptions or kinks in helical structures, impacting the protein’s final shape and function. Understanding these contributions enhances our knowledge of protein behavior and is fundamental in fields like bioinformatics and drug design.
  • Amino acids determine protein structure through unique properties.
  • Protein folding is driven by interactions between amino acid side chains.
  • Knowledge of amino acid properties is vital for understanding protein function and design.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

The spider venom from the Chilean Rose Tarantula (Grammostola spatulata) contains a toxin that is a 34 -amino acid protein. It is thought to be a globular protein that partitions into the lipid membrane to exert its effect. The sequence of the protein is: ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF (a) Identify the hydrophobic and highly hydrophilic amino acids in the protein. (b) The protein is thought to have a hydrophobic face that interacts with the lipid membrane. How can the hydrophobic amino acids far apart in sequence interact to form a hydrophobic face? [Adapted from Lee, S. and MacKinnon, R. (2004). Nature 430: 232-235.]

(a) Characterize the hydrogen-bonding pattern of (1) an \(\alpha\) helix and \((2)\) a collagen triple helix. (b) Explain how the amino acid side chains are arranged in each of these helices.

The larval form of the parasite Schistosoma mansoni infects humans by penetrating the skin. The larva secretes enzymes that catalyze the cleavage of peptide bonds between residues \(\mathrm{X}\) and \(\mathrm{Y}\) in the sequence -Gly-Pro-X-Y- \((X\) and \(Y\) can be any of several amino acids). Why is this enzyme activity important for the parasite?

Fetal hemoglobin (Hb F) contains serine in place of the cationic histidine at position 143 of the \(\beta\) chains of adult hemoglobin (Hb \(\mathrm{A}\) ). Residue 143 faces the central cavity between the \(\beta\) chains. (a) Why does \(2,3 \mathrm{BPG}\) bind more tightly to deoxy Hb A than to deoxy Hb F? (b) How does the decreased affinity of \(\mathrm{Hb} \mathrm{F}\) for \(2,3 \mathrm{BPG}\) affect the affinity of \(\mathrm{Hb} \mathrm{F}\) for \(\mathrm{O}_{2}\) ? (c) The \(\mathrm{P}_{50}\) for \(\mathrm{Hb} \mathrm{F}\) is 18 torr, and the \(P_{50}\) for \(\mathrm{Hb} \mathrm{A}\) is 26 torr. How do these values explain the efficient transfer of oxygen from maternal blood to the fetus?

Myoglobin contains eight \(\alpha\) helices, one of which has the following sequence: $$ \text { -Gln-Gly-Ala-Met-Asn-Lys-Ala-Leu–Glu-His-Phe-Arg-Lys- } $$ $$ \text { Asp-Ile-Ala-Ala- } $$ Which side chains are likely to be on the side of the helix that faces the interior of the protein? Which are likely to be facing the aqueous solvent? Account for the spacing of the residues facing the interior.

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.