/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 14 The spider venom from the Chilea... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

The spider venom from the Chilean Rose Tarantula (Grammostola spatulata) contains a toxin that is a 34 -amino acid protein. It is thought to be a globular protein that partitions into the lipid membrane to exert its effect. The sequence of the protein is: ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF (a) Identify the hydrophobic and highly hydrophilic amino acids in the protein. (b) The protein is thought to have a hydrophobic face that interacts with the lipid membrane. How can the hydrophobic amino acids far apart in sequence interact to form a hydrophobic face? [Adapted from Lee, S. and MacKinnon, R. (2004). Nature 430: 232-235.]

Short Answer

Expert verified
In the sequence ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF, hydrophobic amino acids include C, G, F, M, W, L, A, P whereas hydrophilic amino acids include E, K, N, D, S with E, K, D being highly hydrophilic. Hydrophobic amino acids that are far apart in sequence can interact to form a hydrophobic face due to protein's ability to fold into a 3D structure, hence creating a hydrophobic face that could interact with lipid membranes.

Step by step solution

01

Identify Hydrophobic and Hydrophilic Amino Acids

By referring to the known properties of the 20 standard amino acids, identify the hydrophobic and hydrophilic amino acids in the sequence. Hydrophobic amino acids include: A (Alanine), V (Valine), L (Leucine), I (Isoleucine), P (Proline), F (Phenylalanine), M (Methionine), and W (Tryptophan). While hydrophilic amino acids include: R (Arginine), N (Asparagine), D (Aspartic acid), C (Cysteine), E (Glutamic acid), Q (Glutamine), H (Histidine), K (Lysine), S (Serine), T (Threonine), Y (Tyrosine). Notably, any amino acid with R, K, D, or E is considered highly hydrophilic.
02

Identify Hydrophobic and Hydrophilic Amino Acids in the Sequence

In the sequence ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF, the hydrophobic amino acids are C, G, F, M, W, L, A and P. The hydrophilic amino acids are E, K, N, D, and S. Specifically, the highly hydrophilic ones are E, K and D.
03

Understand Protein Folding

Proteins don't exist in linear straight chains but rather fold and coil into specific 3D structures due to various interactions, such as hydrophobic interactions, hydrogen bonds, ionic bonds, Van der Waals forces, and disulfide bonds. This implies that amino acids distant from each other in the sequence could possibly end up close to each other in the protein's 3D structure.
04

Visualize Hydrophobic Face Formation

The globular structure resulting from protein folding could bring together the hydrophobic amino acids, which are initially apart in the linear sequence, to form a hydrophobic face. This face doesn't interact with the water environment, and is best suited for interaction with hydrophobic substances, such as the lipid membrane.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Hydrophobic and Hydrophilic Amino Acids
Understanding the nature of amino acids is crucial for grasping how proteins interact with different environments. Amino acids, the building blocks of proteins, can be categorized based on their affinity towards water. Some, termed hydrophobic, have a tendency to avoid water and seek out other non-polar molecules. These include amino acids like Alanine, Valine, and Tryptophan, which typically have non-polar side chains.

On the other hand, hydrophilic amino acids, such as Lysine and Aspartic acid, possess polar side chains that can form bonds with water, thus making these amino acids soluble in aqueous environments.

Identifying these qualities in a protein sequence, like the toxin from the Grammostola spatulata, provides insights into how the protein will interact with its surroundings, such as the hydrophobic interior of a lipid membrane or the hydrophilic external environment.
Protein Folding
Protein folding is a sophisticated process that transforms a polypeptide chain into a functional three-dimensional structure. The sequence of amino acids dictates how the chain will fold, driven by interactions among amino acids. When hydrophobic amino acids are brought together as the protein folds, they can form a 'hydrophobic core', often leading to a more stable structure as they avoid water.

Other interactions such as hydrogen bonds, ionic bonds, and Van der Waals forces also play pivotal roles. Misfolding can lead to loss of function or even diseases. Proteins may utilize molecular chaperones to ensure they achieve their correct conformation.
Globular Protein Structure
Globular proteins are somewhat spherical in shape and are characterized by their water-soluble nature. Due to protein folding, these proteins often have a hydrophobic core with the hydrophilic amino acids situated on the outside, allowing them to be soluble in the cellular environment.

The toxin from the tarantula is thought to be a globular protein that inserts into lipid membranes. This integration requires the protein to expose hydrophobic areas to interact with the lipid's hydrophobic tails, while the hydrophilic regions remain exposed to the aqueous environment.
Biochemistry Education
Teaching biochemistry involves clearly presenting complex concepts such as protein-lipid interactions. The focus is on helping learners recognize the fundamental principles that govern protein structure and function.

Educators often use real-world examples, like venom proteins, to highlight these principles at work. Approachable analogies, interactive models, and visual aids greatly enhance understanding. Critical thinking is encouraged by posing questions, for instance, on how the sequence of amino acids influences the 3D shape and interaction properties of proteins. Proper biochemistry education lays the foundation for future research and applications in medicine, pharmacology, and biotechnology.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

Fetal hemoglobin (Hb F) contains serine in place of the cationic histidine at position 143 of the \(\beta\) chains of adult hemoglobin (Hb \(\mathrm{A}\) ). Residue 143 faces the central cavity between the \(\beta\) chains. (a) Why does \(2,3 \mathrm{BPG}\) bind more tightly to deoxy Hb A than to deoxy Hb F? (b) How does the decreased affinity of \(\mathrm{Hb} \mathrm{F}\) for \(2,3 \mathrm{BPG}\) affect the affinity of \(\mathrm{Hb} \mathrm{F}\) for \(\mathrm{O}_{2}\) ? (c) The \(\mathrm{P}_{50}\) for \(\mathrm{Hb} \mathrm{F}\) is 18 torr, and the \(P_{50}\) for \(\mathrm{Hb} \mathrm{A}\) is 26 torr. How do these values explain the efficient transfer of oxygen from maternal blood to the fetus?

Explain why (1) glycine and (2) proline residues are not commonly found in \(\alpha\) helices.

Gelatin is processed collagen that comes from the joints of animals. When gelatin is mixed with hot water, the triple helix structure unwinds and the chains separate, becoming random coils that dissolve in the water. As the dissolved gelatin mixture cools, the collagen forms a matrix that traps water; as a result, the mixture turns into the jiggling semisolid mass that is recognizable as Jell- \(\mathrm{O}^{\mathrm{m}}\). The directions on a box of gelatin include the following: "Chill until slightly thickened, then add 1 to 2 cups cooked or raw fruits or vegetables. Fresh or frozen pineapple must be cooked before adding." If the pineapple is not cooked, the gelatin will not set properly. Pineapple belongs to a group of plants called Bromeliads and contains a protease called bromelain. Explain why pineapple must be cooked before adding to gelatin.

(a) How does the reaction of carbon dioxide with water help explain the Bohr effect? Include the equation for the formation of bicarbonate ion from \(\mathrm{CO}_{2}\) and water, and explain the effects of \(\mathrm{H}^{\oplus}\) and \(\mathrm{CO}_{2}\) on hemoglobin oxygenation. (b) Explain the physiological basis for the intravenous administration of bicarbonate to shock victims.

Amino acid substitutions at the \(\alpha \beta\) subunit interfaces of hemoglobin may interfere with the \(R \rightleftharpoons T\) quaternary structural changes that take place on oxygen binding. In the hemoglobin variant \(\mathrm{Hb}_{\text {Yakima }}\), the \(\mathrm{R}\) form is stabilized relative to the \(\mathrm{T}\) form, and \(P_{50}=12\) torr. Explain why the mutant hemoglobin is less efficient than normal hemoglobin \(\left(P_{50}=26\right.\) torr \()\) in delivering oxygen to working muscle, where \(\mathrm{O}_{2}\) may be as low as 10 to 20 torr.

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.