/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Free solutions & answers for Principles of Biochemistry Chapter 4 - (Page 1) [step by step] | 91Ó°ÊÓ

91Ó°ÊÓ

Problem 2

(a) Characterize the hydrogen-bonding pattern of (1) an \(\alpha\) helix and \((2)\) a collagen triple helix. (b) Explain how the amino acid side chains are arranged in each of these helices.

Problem 3

Explain why (1) glycine and (2) proline residues are not commonly found in \(\alpha\) helices.

Problem 8

Myoglobin contains eight \(\alpha\) helices, one of which has the following sequence: $$ \text { -Gln-Gly-Ala-Met-Asn-Lys-Ala-Leu–Glu-His-Phe-Arg-Lys- } $$ $$ \text { Asp-Ile-Ala-Ala- } $$ Which side chains are likely to be on the side of the helix that faces the interior of the protein? Which are likely to be facing the aqueous solvent? Account for the spacing of the residues facing the interior.

Problem 10

The larval form of the parasite Schistosoma mansoni infects humans by penetrating the skin. The larva secretes enzymes that catalyze the cleavage of peptide bonds between residues \(\mathrm{X}\) and \(\mathrm{Y}\) in the sequence -Gly-Pro-X-Y- \((X\) and \(Y\) can be any of several amino acids). Why is this enzyme activity important for the parasite?

Problem 11

(a) How does the reaction of carbon dioxide with water help explain the Bohr effect? Include the equation for the formation of bicarbonate ion from \(\mathrm{CO}_{2}\) and water, and explain the effects of \(\mathrm{H}^{\oplus}\) and \(\mathrm{CO}_{2}\) on hemoglobin oxygenation. (b) Explain the physiological basis for the intravenous administration of bicarbonate to shock victims.

Problem 12

Fetal hemoglobin (Hb F) contains serine in place of the cationic histidine at position 143 of the \(\beta\) chains of adult hemoglobin (Hb \(\mathrm{A}\) ). Residue 143 faces the central cavity between the \(\beta\) chains. (a) Why does \(2,3 \mathrm{BPG}\) bind more tightly to deoxy Hb A than to deoxy Hb F? (b) How does the decreased affinity of \(\mathrm{Hb} \mathrm{F}\) for \(2,3 \mathrm{BPG}\) affect the affinity of \(\mathrm{Hb} \mathrm{F}\) for \(\mathrm{O}_{2}\) ? (c) The \(\mathrm{P}_{50}\) for \(\mathrm{Hb} \mathrm{F}\) is 18 torr, and the \(P_{50}\) for \(\mathrm{Hb} \mathrm{A}\) is 26 torr. How do these values explain the efficient transfer of oxygen from maternal blood to the fetus?

Problem 13

Amino acid substitutions at the \(\alpha \beta\) subunit interfaces of hemoglobin may interfere with the \(R \rightleftharpoons T\) quaternary structural changes that take place on oxygen binding. In the hemoglobin variant \(\mathrm{Hb}_{\text {Yakima }}\), the \(\mathrm{R}\) form is stabilized relative to the \(\mathrm{T}\) form, and \(P_{50}=12\) torr. Explain why the mutant hemoglobin is less efficient than normal hemoglobin \(\left(P_{50}=26\right.\) torr \()\) in delivering oxygen to working muscle, where \(\mathrm{O}_{2}\) may be as low as 10 to 20 torr.

Problem 14

The spider venom from the Chilean Rose Tarantula (Grammostola spatulata) contains a toxin that is a 34 -amino acid protein. It is thought to be a globular protein that partitions into the lipid membrane to exert its effect. The sequence of the protein is: ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF (a) Identify the hydrophobic and highly hydrophilic amino acids in the protein. (b) The protein is thought to have a hydrophobic face that interacts with the lipid membrane. How can the hydrophobic amino acids far apart in sequence interact to form a hydrophobic face? [Adapted from Lee, S. and MacKinnon, R. (2004). Nature 430: 232-235.]

Problem 16

Gelatin is processed collagen that comes from the joints of animals. When gelatin is mixed with hot water, the triple helix structure unwinds and the chains separate, becoming random coils that dissolve in the water. As the dissolved gelatin mixture cools, the collagen forms a matrix that traps water; as a result, the mixture turns into the jiggling semisolid mass that is recognizable as Jell- \(\mathrm{O}^{\mathrm{m}}\). The directions on a box of gelatin include the following: "Chill until slightly thickened, then add 1 to 2 cups cooked or raw fruits or vegetables. Fresh or frozen pineapple must be cooked before adding." If the pineapple is not cooked, the gelatin will not set properly. Pineapple belongs to a group of plants called Bromeliads and contains a protease called bromelain. Explain why pineapple must be cooked before adding to gelatin.

Access millions of textbook solutions in one place

  • Access over 3 million high quality textbook solutions
  • Access our popular flashcard, quiz, mock-exam and notes features
  • Access our smart AI features to upgrade your learning
Access millions of textbook solutions in one place

Recommended explanations on Chemistry Textbooks