/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 10 The larval form of the parasite ... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

The larval form of the parasite Schistosoma mansoni infects humans by penetrating the skin. The larva secretes enzymes that catalyze the cleavage of peptide bonds between residues \(\mathrm{X}\) and \(\mathrm{Y}\) in the sequence -Gly-Pro-X-Y- \((X\) and \(Y\) can be any of several amino acids). Why is this enzyme activity important for the parasite?

Short Answer

Expert verified
The enzyme activity is vital for the Schistosoma mansoni larva as it allows it to penetrate the host's skin. By catalyzing the cleavage of specific peptide bonds in the skin tissues, the parasite can establish infection, which is integral to its survival and reproduction.

Step by step solution

01

Understanding Enzymes and Parasitic Infections

Enzymes are biological catalysts that speed up chemical reactions in organisms. A parasite like Schistosoma mansoni infects a host to survive and reproduce. It must have developed a mechanism to bypass or overcome the host's defenses. To start, the larva secretes enzymes that target specific peptide bonds in the skin's tissues.
02

Unraveling the Enzyme's Targets

Based on the sequence given -Gly-Pro-X-Y-, it's clear that the larva's enzyme catalyzes the cleavage of peptide bonds between an unspecified X and Y residue. By breaking down these peptide bonds, the parasite can penetrate the host's skin and establish an infection.
03

Assessing the Importance of Enzyme Activity

The importance of this enzymic activity for the parasite lies in its attack and survival strategy. The ability to cleave these specific peptide bonds allows the parasite to breach the skin barrier (the body's first line of defense), infect the host organism, and possibly compromise the immune response. Therefore, the enzyme plays a crucial role in penetrating the host's skin and maintaining the parasite's life cycle.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Schistosoma mansoni
Schistosoma mansoni is a type of parasitic flatworm, commonly known as a blood fluke. This specific parasite is responsible for a condition called schistosomiasis, which is prevalent in tropical regions. The life cycle of Schistosoma mansoni is complex, involving both a freshwater snail and a mammal, such as a human, as hosts.

When the cercariae (larval stage of the parasite) are released from snails into the water, they actively seek out human hosts to continue their life cycle. Upon contacting human skin, these larvae have mechanisms, particularly enzyme secretion, that assist in their penetration through the skin.
  • These enzymes enable the larvae to breach the human body's natural defenses effectively.
  • Once inside the body, the larvae develop into adult flukes that reside in blood vessels, where they can cause lasting harm.
Understanding the biology and infection strategies of Schistosoma mansoni is critical for combating diseases like schistosomiasis.
Peptide Bond Cleavage
Peptide bond cleavage is a biochemical reaction where the bonds linking amino acids in proteins are broken. In proteins, peptide bonds hold the amino acids together in a specific sequence, forming the protein's structure.

For Schistosoma mansoni, the larval enzyme's activity focuses on cleaving peptide bonds between residues in specific sequences, such as -Gly-Pro-X-Y-. These bonds are crucial in the structure and integrity of skin proteins.
  • Cleaving peptide bonds helps break down proteins in the host tissue, facilitating the parasite's entry.
  • The precision at which the enzyme works underlines its importance in overcoming the host's defense mechanisms.
The ability to disrupt these bonds makes the enzyme a powerful tool for the parasite to establish infection.
Host-Pathogen Interaction
Host-pathogen interaction describes how pathogens like Schistosoma mansoni interact with their host organism during an infection. This interaction is dynamic, often involving the pathogen's invasion strategies and the host's immune responses.

Parasitic enzymes, such as those secreted by the Schistosoma mansoni larva, play a crucial role in this interaction. They target the host’s structural defenses at the molecular level to facilitate pathogen entry.
  • The host initially reacts by attempting to block or repair tissue damage caused by the parasite.
  • However, the parasite's enzymes help it evade these defenses by dismantling cellular structures like peptide bonds.
Understanding host-pathogen interactions provides valuable insights into infection processes, which is essential for developing effective treatments and preventive strategies.
Larval Infection Mechanism
The larval infection mechanism of Schistosoma mansoni is a highly specialized process that enables the parasite to successfully invade the host. This mechanism involves multiple steps, with enzyme secretion being a critical component.

The first step is the release of cercariae into freshwater, where they seek mammalian hosts. Upon contact with human skin, these larvae use enzyme secretion to break down the tissue’s structural integrity.
  • The enzymes target peptide bonds in the skin, weakening it enough for the larvae to penetrate.
  • Once through the skin, the larvae migrate through the bloodstream, eventually reaching the liver and maturing into adult flukes.
The larval infection mechanism not only ensures survival at the entry point but also allows the parasite to establish a prolonged presence within the host, contributing to its life cycle and the spread of schistosomiasis.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

Fetal hemoglobin (Hb F) contains serine in place of the cationic histidine at position 143 of the \(\beta\) chains of adult hemoglobin (Hb \(\mathrm{A}\) ). Residue 143 faces the central cavity between the \(\beta\) chains. (a) Why does \(2,3 \mathrm{BPG}\) bind more tightly to deoxy Hb A than to deoxy Hb F? (b) How does the decreased affinity of \(\mathrm{Hb} \mathrm{F}\) for \(2,3 \mathrm{BPG}\) affect the affinity of \(\mathrm{Hb} \mathrm{F}\) for \(\mathrm{O}_{2}\) ? (c) The \(\mathrm{P}_{50}\) for \(\mathrm{Hb} \mathrm{F}\) is 18 torr, and the \(P_{50}\) for \(\mathrm{Hb} \mathrm{A}\) is 26 torr. How do these values explain the efficient transfer of oxygen from maternal blood to the fetus?

Myoglobin contains eight \(\alpha\) helices, one of which has the following sequence: $$ \text { -Gln-Gly-Ala-Met-Asn-Lys-Ala-Leu–Glu-His-Phe-Arg-Lys- } $$ $$ \text { Asp-Ile-Ala-Ala- } $$ Which side chains are likely to be on the side of the helix that faces the interior of the protein? Which are likely to be facing the aqueous solvent? Account for the spacing of the residues facing the interior.

(a) How does the reaction of carbon dioxide with water help explain the Bohr effect? Include the equation for the formation of bicarbonate ion from \(\mathrm{CO}_{2}\) and water, and explain the effects of \(\mathrm{H}^{\oplus}\) and \(\mathrm{CO}_{2}\) on hemoglobin oxygenation. (b) Explain the physiological basis for the intravenous administration of bicarbonate to shock victims.

Amino acid substitutions at the \(\alpha \beta\) subunit interfaces of hemoglobin may interfere with the \(R \rightleftharpoons T\) quaternary structural changes that take place on oxygen binding. In the hemoglobin variant \(\mathrm{Hb}_{\text {Yakima }}\), the \(\mathrm{R}\) form is stabilized relative to the \(\mathrm{T}\) form, and \(P_{50}=12\) torr. Explain why the mutant hemoglobin is less efficient than normal hemoglobin \(\left(P_{50}=26\right.\) torr \()\) in delivering oxygen to working muscle, where \(\mathrm{O}_{2}\) may be as low as 10 to 20 torr.

The spider venom from the Chilean Rose Tarantula (Grammostola spatulata) contains a toxin that is a 34 -amino acid protein. It is thought to be a globular protein that partitions into the lipid membrane to exert its effect. The sequence of the protein is: ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF (a) Identify the hydrophobic and highly hydrophilic amino acids in the protein. (b) The protein is thought to have a hydrophobic face that interacts with the lipid membrane. How can the hydrophobic amino acids far apart in sequence interact to form a hydrophobic face? [Adapted from Lee, S. and MacKinnon, R. (2004). Nature 430: 232-235.]

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.