/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 13 Amino acid substitutions at the ... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

Amino acid substitutions at the \(\alpha \beta\) subunit interfaces of hemoglobin may interfere with the \(R \rightleftharpoons T\) quaternary structural changes that take place on oxygen binding. In the hemoglobin variant \(\mathrm{Hb}_{\text {Yakima }}\), the \(\mathrm{R}\) form is stabilized relative to the \(\mathrm{T}\) form, and \(P_{50}=12\) torr. Explain why the mutant hemoglobin is less efficient than normal hemoglobin \(\left(P_{50}=26\right.\) torr \()\) in delivering oxygen to working muscle, where \(\mathrm{O}_{2}\) may be as low as 10 to 20 torr.

Short Answer

Expert verified
The mutant hemoglobin Hb Yakima has higher affinity for oxygen, as observed from its lower \(P_{50}\) value. It stays more in the \(\mathrm{R}\) form and unable to effectively release oxygen in the working muscles where oxygen concentration might be low, hence less efficient in delivering oxygen than normal hemoglobin.

Step by step solution

01

Understanding The Hemoglobin Forms

The \(\mathrm{R}\) form of hemoglobin is the relaxed state, and it is more capable of binding to \(\mathrm{O}_{2}\). Conversely, the \(\mathrm{T}\) form is the tense state and has a reduced binding affinity for \(\mathrm{O}_{2}\). Mutations that stabilize the \(\mathrm{R}\) form over the \(\mathrm{T}\) form would lead to an overall increase in oxygen binding.
02

Comparing P50 Values

The \(P_{50}\) value for the \(\mathrm{Hb}_{\mathrm{Yakima}}\) variant is 12 torr, which is less than the \(P_{50}\) value for normal hemoglobin (26 torr). This indicates that the \(\mathrm{Hb}_{\mathrm{Yakima}}\) has a stronger binding affinity for \(\mathrm{O}_{2}\) than the normal hemoglobin. Therefore, the \(\mathrm{Hb}_{\mathrm{Yakima}}\) will be more saturated with \(\mathrm{O}_{2}\) at lower partial pressures.
03

Explaining Oxygen Delivery

Hemoglobin's role is to deliver \(\mathrm{O}_{2}\) from the lungs to the working muscles where \(\mathrm{O}_{2}\) concentration might be low. For this, it picks up \(\mathrm{O}_{2}\) at high \(\mathrm{O}_{2}\) partial pressure in lungs and unloads it at lower \(\mathrm{O}_{2}\) pressure in working muscles. After releasing \(\mathrm{O}_{2}\), hemoglobin should return to \(\mathrm{T}\) form to be able to take more oxygen. But, as \(\mathrm{Hb}_{\mathrm{Yakima}}\) stays more at \(\mathrm{R}\) form, it fails to unload \(\mathrm{O}_{2}\) effectively in the working muscles, therefore, it is less efficient in delivering oxygen.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

R and T states of hemoglobin
The hemoglobin molecule serves a critical role in transporting oxygen from the lungs to tissues and organs throughout the body. It does so through a sophisticated mechanism involving two different quaternary structures: the R state, known as the 'relaxed' state, and the T state, referred to as the 'tense' state.

When hemoglobin binds to oxygen in the lungs, where the oxygen concentration is high, it adopts the R state, which has a high affinity for oxygen. This makes it very effective at picking up oxygen. Once it reaches tissues where oxygen concentration is low, the oxygen molecules dissociate from hemoglobin, which transitions into the T state. This state has a lower affinity for oxygen, making it easier to release oxygen to the tissues that need it.

The ability of hemoglobin to switch between the R and T states is crucial for its function, as it allows for efficient oxygen uptake and release. Environmental factors and biochemical changes can influence the balance between these two states, affecting oxygen delivery to tissues.
P50 value in hemoglobin
P50 is a term that represents the partial pressure of oxygen when hemoglobin is 50% saturated. It's a valuable measure to understand hemoglobin's oxygen-binding affinity. Normal hemoglobin typically has a P50 value of 26 torr, indicating the partial pressure at which half of the hemoglobin sites are occupied by oxygen.

When the P50 value is lower, as is the case with the hemoglobin variant Hb Yakima (12 torr), it suggests that the hemoglobin has a stronger affinity for oxygen. In other words, it binds to oxygen more tightly and releases it less readily. While this might seem beneficial, as the hemoglobin remains more saturated with oxygen even at lower oxygen pressures, it creates a problematic scenario for oxygen delivery.

For oxygen to be released to tissues, especially those under metabolic stress like working muscles, hemoglobin must transition from its oxygen-loaded R state to the T state, which favors oxygen release. A low P50 value can impede this transition, leading to reduced oxygen delivery where it's most needed.
Mutation effects on oxygen delivery
Specific mutations in the hemoglobin molecule can lead to a change in its structure and consequently, its function. The hemoglobin variant Hb Yakima is one such example, where a mutation stabilizes the R form over the T form. Because of this stabilization, oxygen remains bound even when the hemoglobin reaches tissues with low oxygen concentration.

Stabilizing the R state beyond normal promotes increased oxygen affinity, which is not ideal for oxygen delivery to peripheral tissues. Muscle tissue, especially when exercising, requires a surge in oxygen supply. Under normal conditions, hemoglobin releases oxygen more readily due to a higher T state inclination in low oxygen environments, such as in functioning muscle. However, in the Hb Yakima variant, this release of oxygen is compromised due to the preferential stabilizing mutation.

As a result, even though these mutated hemoglobin molecules are more saturated with oxygen, they cannot effectively offload it, leading to a reduced delivery of oxygen to where it is acutely needed in the body. This demonstrates how even subtle changes at the molecular level can have significant physiological impacts.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

(a) Characterize the hydrogen-bonding pattern of (1) an \(\alpha\) helix and \((2)\) a collagen triple helix. (b) Explain how the amino acid side chains are arranged in each of these helices.

Explain why (1) glycine and (2) proline residues are not commonly found in \(\alpha\) helices.

Gelatin is processed collagen that comes from the joints of animals. When gelatin is mixed with hot water, the triple helix structure unwinds and the chains separate, becoming random coils that dissolve in the water. As the dissolved gelatin mixture cools, the collagen forms a matrix that traps water; as a result, the mixture turns into the jiggling semisolid mass that is recognizable as Jell- \(\mathrm{O}^{\mathrm{m}}\). The directions on a box of gelatin include the following: "Chill until slightly thickened, then add 1 to 2 cups cooked or raw fruits or vegetables. Fresh or frozen pineapple must be cooked before adding." If the pineapple is not cooked, the gelatin will not set properly. Pineapple belongs to a group of plants called Bromeliads and contains a protease called bromelain. Explain why pineapple must be cooked before adding to gelatin.

The spider venom from the Chilean Rose Tarantula (Grammostola spatulata) contains a toxin that is a 34 -amino acid protein. It is thought to be a globular protein that partitions into the lipid membrane to exert its effect. The sequence of the protein is: ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF (a) Identify the hydrophobic and highly hydrophilic amino acids in the protein. (b) The protein is thought to have a hydrophobic face that interacts with the lipid membrane. How can the hydrophobic amino acids far apart in sequence interact to form a hydrophobic face? [Adapted from Lee, S. and MacKinnon, R. (2004). Nature 430: 232-235.]

Fetal hemoglobin (Hb F) contains serine in place of the cationic histidine at position 143 of the \(\beta\) chains of adult hemoglobin (Hb \(\mathrm{A}\) ). Residue 143 faces the central cavity between the \(\beta\) chains. (a) Why does \(2,3 \mathrm{BPG}\) bind more tightly to deoxy Hb A than to deoxy Hb F? (b) How does the decreased affinity of \(\mathrm{Hb} \mathrm{F}\) for \(2,3 \mathrm{BPG}\) affect the affinity of \(\mathrm{Hb} \mathrm{F}\) for \(\mathrm{O}_{2}\) ? (c) The \(\mathrm{P}_{50}\) for \(\mathrm{Hb} \mathrm{F}\) is 18 torr, and the \(P_{50}\) for \(\mathrm{Hb} \mathrm{A}\) is 26 torr. How do these values explain the efficient transfer of oxygen from maternal blood to the fetus?

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.