/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 10 Removal of a Low-Level Contamina... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

Removal of a Low-Level Contaminant One mode in which adsorbents are used is to strip a low-level contaminant like DNA from a product solution. No other solution components are negatively charged at the operating \(\mathrm{pH}\) for the column. (a) If an anion exchanger is used for this purpose, determine the total bed capacity for DNA given these parameters: bed volume \(=2\) liters, \(S_{\text {tot }}=2 \mathrm{mg} / \mathrm{ml}, K_{\text {eq }}=2 \mathrm{ml} / \mathrm{mg}\), and DNA concentration \(=5 \mu \mathrm{g} / \mathrm{ml}\). (b) Determine the bed capacity for the same conditions except that the DNA concentration is \(100 \mu \mathrm{g} / \mathrm{ml}\).

Short Answer

Expert verified
The total bed capacity for DNA for part a is 0.0196 \(\mathrm{mg/ml}\) and for part b it is 0.6667 \(\mathrm{mg/ml}\)

Step by step solution

01

Understanding the problem and parameters

The problem requires to determine the bed capacity for DNA. We are given the bed volume (\(2\) liters), the total amount substance that can be adsorbed (\(S_{\text {tot }}=2 \mathrm{mg} / \mathrm{ml}\)), the DNA concentration (\(5 \mu \mathrm{g} / \mathrm{ml}\)), and the equilibrium constant (\(K_{\text {eq }}\)).
02

Solution for (a)

To find the bed capacity, we can use the formula for capacity in an ion exchange system given by: \[ Q_{t} = S_{\text {tot}} \times C / (1 + K_{\text {eq}} \times C) \]Where \(Q_{t}\) is the bed capacity, \(S_{\text {tot}}\) is the total substance to be adsorbed, \(C\) is the contaminant concentration, and \(K_{\text {eq}}\) is the equilibrium constant. The units need to be adjusted such that they all align, let's convert DNA concentration to \(mg/ml\) from \(\mu \mathrm{g} / \mathrm{ml}\). \[ C = 5 \mu \mathrm{g} / \mathrm{ml} = 0.005 \mathrm{mg} / \mathrm{ml} \]Now we substitute the numbers into our initial formula and solve: \[ Q_{t} = 2 \times 0.005 / (1 + 2 \times 0.005) = 0.0196 \mathrm{mg/ml}\]
03

Solution for (b)

Now lets solve for DNA concentration of \(100 \mu \mathrm{g} / \mathrm{ml}\). We first convert the concentration to \(\mathrm{mg/ml}\):\[ C = 100 \mu \mathrm{g} / \mathrm{ml} = 0.1 \mathrm{mg} / \mathrm{ml} \]Substitute all the numbers in:\[ Q_{t} = 2 \times 0.1 / (1 + 2 \times 0.1) = 0.6667 \mathrm{mg/ml}\]

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Adsorption
Adsorption is a crucial process in bioseparations, particularly in biotechnology and chemical engineering. It occurs when molecules from a liquid or gas phase adhere to a solid surface, forming a thin film. This process is utilized to purify liquids and gases, capturing impurities on a material called adsorbent.

In bioseparations, adsorption can selectively extract components from complex mixtures. The surface area and chemical properties of the adsorbent determine its effectiveness. A larger surface area allows more material to be captured, while the chemical affinity dictates selectivity.
  • Effective for removing contaminants at low concentrations.
  • Adsorbents may be particles packed in a column or sheets in a flow system.
  • Regeneration of adsorbents can occur through desorption, where the captured material is released, allowing the adsorbent to be reused.
For applications like DNA removal, adsorption plays a vital role. It can efficiently capture DNA molecules, ensuring product purity and performance. The process involves carefully selecting adsorbents and operating conditions to achieve desired separation outcomes.
Ion Exchange
Ion exchange is a popular technique in bioseparations. It involves exchanging ions between a solution and an insoluble ion exchanger, typically a resin. The resin contains charged groups that capture ions from the liquid, facilitating the removal or capture of specific molecules, such as DNA or proteins.

In anion exchange, resins with positively charged groups are used to attract and bind negatively charged ions. For DNA removal, anion exchangers can efficiently capture negatively charged DNA molecules.
  • Involves reversible exchange of ions, allowing for regeneration and reuse of resin.
  • Highly selective; the choice of resin and conditions dictate what ions are captured.
  • Widely used for water purification, protein purification, and nucleotide removal.
The resin's capacity is a key parameter, influenced by factors such as ion concentration and equilibrium conditions. Adjusting these can optimize the process for desired outcomes, e.g., higher DNA concentrations require different capacity calculations.
DNA Removal
Removing DNA from biological or chemical mixtures is critical in diverse fields like pharmaceuticals and biotechnology. Contaminating DNA can interfere with processes and affect product quality.

DNA removal often utilizes techniques like adsorption and ion exchange. The goal is effective capture of DNA to ensure the final product is free from genetic material.
  • Ensures purity and stability of the final product.
  • Critical in drug development, bioproduct manufacturing, and diagnostics.
  • Requires precise control of conditions to avoid the co-removal of desired components.
DNA molecules are typically negatively charged, enabling methods like anion exchange to be highly effective. Adjusting factors like pH and ionic strength enhances removal efficiency. For low-level contaminants, specific adsorbents and conditions ensure all DNA is effectively captured, safeguarding quality and efficacy of the bioproduct.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

Langmuir Isotherm For the Langmuir isotherm [Equation (7.2.6)], determine the relationship between the equilibrium constant \(K_{\text {eq }}\) and the mobile phase concentration [C] when the adsorbent is half saturated.

Chromatographic Separation of a Protein A protein is being separated on a chromatography column. The protein has been found to obey the Langmuir isotherm, with \(S_{\text {lot }}=300 \mu \mathrm{g} / \mathrm{ml}\) and \(K_{\text {eq }}=10 \mathrm{ml} / \mathrm{mg}\). The concentration of the protein in the feed ( 3 liters) to the column is \(2 \mathrm{mg} / \mathrm{ml}\). The column flow rate is \(2.0\) liters/min. The column is \(50 \mathrm{~cm}\) in diameter and \(100 \mathrm{~cm}\) long. The void fraction of the chromatography bed is \(0.35 .\) Determine (a) the time for the protein shock front to exit the column, and (b) the time when the concentration of the protein in the diffuse wave is \(0.01 \mathrm{mg} / \mathrm{ml}\) at the exit of the column.

Dispersion versus Molecular Diffusivity What is the difference between the effective dispersivity \(\mathscr{_}{\mathrm{eff}}\) and molecular diffusivity \(\odot_{\mathrm{m}}\) ? What are the units for each?

Design of a Protein Purification Process (Mini-Case Study) Propose a purification process for the protein described. Assume a bacterial process. Design of the process will involve estimation of protein properties, for which a spreadsheet is provided at the textbook website (http://www.biosep.ou.edu). (Protein adapted from H. Zou, T. J. McGarry, T. Bernal, and M. W. Kirschner, "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis," Science, vol. 285, pp. \(418-422,1999 .)\) Sequence 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVKT-1\ldots.....S-S \(\ldots \ldots+1\) KGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Research Production Process A PCR-amplified gene was cloned into a modified pET28a vector to express recombinant protein in \(E\). coli. Protein more than \(90 \%\) pure was obtained by affinity purification with Ni-nitrilotriacetic acid (NTA) beads followed by Resource Q column chromatography. In addition to the traditional process and host-cell-related impurities, the following substance related impurities are present in the process: Impurity 1: Des-Met (N-terminal methionine deleted for the desired protein) Impurity 2: C-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10) 1 ENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 43 APPACLPKATRKALGTVNRATEKSVK \(=1=\cdots \cdots\) TKGPLKQKQPSCFSAKKMTEKTCVKAKS 97 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 148 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Impurity 3: N-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10 ) 1 MATLIYVDK Impurity 4: Misfolded isoform 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVK- TKGPLKQKQPSCFSAKKMTEKTCVKAKS TKGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLM 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDE Impurity 5: Covalent dimer between cysteine 56 on adjacent molecules Information about chromatography adsorbents can be found through links to vari- ous companies at the textbook website (www.biosep.ou.edu). There is also a link to a spreadsheet to approximate protein charge as a function of pH at the textbook website.

Chromatography Scale-up-Pilot Plant to Plant You are designing a plant scale chromatography to purify a protein. You have pilot scale data with an adequate resolution. In this pilot data, the column has a cross-sectional area \(A_{I}\) and a bed height, \(L_{l}\). The pilot column data has it operating with a gradient going from \(c_{\text {low }, l}\) to \(c_{\text {hi, },}\), and a total gradient volume of \(V_{g .1} / V_{l}\) (in bed volumes). The pilot column is able to produce \(M_{l}\) grams of protein per cycle. You want to scale up the column to produce \(M_{2}\) grams of protein per cycle. You only have one large column available to use, with a cross-sectional area of \(A_{2}\). The maximum pressure drop allowed for the large column is \(\Delta p_{2}\). The particle diameter \(d_{p}\), column void fraction \(\varepsilon\), and solution viscosity \(\mu\) are the same at the pilot plan and plant scales. It is desired to operate the large column at flow rate \(Q_{2}\) at the same resolution as in the pilot scale column. The lower and upper concentrations of the gradient \(\left(c_{l o w}\right.\) and \(c_{h i}\) ) are different for the plant column. For the large column, develop expressions for the maximum allowable bed height and for the bed volumes of the gradient.

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.