/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 2 Langmuir Isotherm For the Langmu... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

Langmuir Isotherm For the Langmuir isotherm [Equation (7.2.6)], determine the relationship between the equilibrium constant \(K_{\text {eq }}\) and the mobile phase concentration [C] when the adsorbent is half saturated.

Short Answer

Expert verified
The relationship between the equilibrium constant and the mobile phase concentration when the adsorbent is half saturated is given by \(K_{eq} = \frac{1-2C}{2C^2}\).

Step by step solution

01

Substitute q

First substitute q. According to the problem, the adsorbent is half saturated, meaning \(q = 0.5q_m\). If we put this into our Langmuir equation, it becomes \(0.5q_m = \frac{q_m K_{eq}C}{1 + K_{eq}C}\).
02

Simplify the equation

Next the equation is simplified by dividing both sides by \(q_m\) to get \(0.5 = \frac{K_{eq}C}{1 + K_{eq}C}\). Dividing both sides of the equation by \(K_{eq}C\) gives \(\frac{0.5}{K_{eq}C} = \frac{1}{1 + K_{eq}C}\).
03

Solve for \(K_{eq}\)

Finally, rearrange the equation to solve for \(K_{eq}\), yielding the equation \(K_{eq} = \frac{1-2C}{2C^2}\).

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Equilibrium constant
The equilibrium constant, often denoted as \( K_{eq} \), plays a crucial role in the Langmuir isotherm. It reflects the balance established when the rate of adsorption of molecules onto a surface equals the rate of their desorption. This constant tells us how strongly the adsorbate sticks to the surface. A higher \( K_{eq} \) signifies a stronger affinity of the adsorbate molecules for the surface, meaning more molecules are likely to stay adsorbed. This constant is pivotal in understanding the distribution of adsorbate between the solid phase and the mobile phase in equilibrium conditions. For students, it's essential to grasp that \( K_{eq} \) provides insights into the efficiency and capacity of the adsorbent.
Adsorption
Adsorption is a process where molecules, ions, or particles from a substance, typically in a gas or liquid phase (mobile phase), adhere to the surface of a solid or a liquid (adsorbent). This occurs due to interactions at a molecular level, often involving van der Waals forces or chemical bonds. In the context of the Langmuir isotherm, adsorption is modeled to be a monolayer process where each site of the adsorbent can hold only one molecule of adsorbate. Important to note is:
  • Adsorption can occur until all available sites on the adsorbent surface are saturated.
  • The rate of adsorption depends on the concentration of the adsorbate in the mobile phase.
The Langmuir isotherm specifically assumes uniform surfaces and identical adsorption sites, giving a simplified, yet powerful model for adsorption processes.
Isotherm equation
The Langmuir isotherm equation is fundamental in describing how molecules adsorb to a surface. It is represented mathematically by:\[ q = \frac{q_m K_{eq} C}{1 + K_{eq}C} \]where:- \( q \) is the amount of adsorbate adsorbed per unit weight of adsorbent,- \( q_m \) is the maximum adsorption capacity (when all sites are filled),- \( C \) is the concentration of the adsorbate in the mobile phase,- \( K_{eq} \) is the equilibrium constant.This equation implies that adsorption increases with concentration but becomes constant at high concentrations as the surface reaches saturation. Understanding this equation helps students predict how the adsorbed amount changes with varying conditions.
Half saturation
Half saturation is a particularly useful point of reference in adsorption isotherms. It occurs when half of the maximum adsorption capacity \( q_m \) is achieved. In the context of the Langmuir isotherm:\[ q = 0.5q_m \]At this point, the surface is said to be "half-saturated," which simplifies the isotherm equation and makes calculations more straightforward. For instance, by knowing half saturation, it's possible to find specific values of \( K_{eq} \):Using the simplified version of the Langmuir equation:\[ 0.5 = \frac{K_{eq}C}{1 + K_{eq}C} \]Solving this provides insight into both \( K_{eq} \) and the relationship with the concentration \( C \). This midpoint helps in determining the efficiency of adsorption under certain conditions, as it marks a balance point between the free adsorbate and the adsorbed material.
Mathematical simplification
Mathematical simplification is key in the application of the Langmuir isotherm, particularly when solving for certain variables. Simplification helps to focus on the core relationships without distraction from complexity. In the exercise provided, for example, we started with the saturation assumption:\[ 0.5q_m = \frac{q_m K_{eq}C}{1 + K_{eq}C} \]By dividing through by \( q_m \), simplifying reduced this equation to a basic form without the variable \( q_m \):\[ 0.5 = \frac{K_{eq}C}{1 + K_{eq}C} \]Further simplification is achieved by manipulating this equation to solve for \( K_{eq} \), resulting in:\[ K_{eq} = \frac{1 - 2C}{2C^2} \]These steps show how algebraic techniques break down the complexity, allowing students to see the relationships between constants and variables more clearly. Simplifications such as these are instrumental in analyzing and solving chemical equations efficiently.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

Estimation of the Number of Theoretical Plates for Ion Exchange Chromatography of a Protein Following a Langmuir Isotherm A \(20 \mathrm{~cm}\) long ion exchange column is loaded with a protein solution at a concentration of \(3 \mathrm{mg} / \mathrm{ml}\) and is eluted isocratically at a superficial velocity of \(30 \mathrm{~cm} / \mathrm{h}\). The void fraction is \(0.3\). The protein has a \(K_{\text {eq }}\) (Langmuir isotherm) of \(1.0 \mathrm{ml} / \mathrm{mg}\), and the column's resin is saturated with the protein at a resin-phase concentration of \(10 \mathrm{mg} / \mathrm{ml}\). If the protein peak has a standard deviation of \(4.0 \mathrm{~min}\), estimate the number of theoretical plates in the column.

Specification of a Column for Protein Chromatography A protein chromatography column that processes \(15 \mathrm{~kg}\) of protein in \(60 \mathrm{~h}\), is cycled every \(6 \mathrm{~h}\), can be loaded with 10 grams of protein per liter of column volume, has a maximum flow rate of 50 liters/ min at a pressure of 4 bar, and is packed with an incompressible resin having a particle diameter of \(90 \mu \mathrm{m}\) and void fraction of \(0.35\). The viscosity can be assumed to be that of water. (a) What are the dimensions required for the column? (b) If the flow rate is 1 column volume per minute and the pressure rating is still 4 bar, what column dimensions are required? Is the resolution equivalent to that for part (a)? (c) If the pressure rating for the column were raised to 12 bar, should the column dimensions change? Is so, what should the dimensions be? Do they make sense? (d) What is the best way to increase the productivity of the column packing?

Design of a Protein Purification Process (Mini-Case Study) Propose a purification process for the protein described. Assume a bacterial process. Design of the process will involve estimation of protein properties, for which a spreadsheet is provided at the textbook website (http://www.biosep.ou.edu). (Protein adapted from H. Zou, T. J. McGarry, T. Bernal, and M. W. Kirschner, "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis," Science, vol. 285, pp. \(418-422,1999 .)\) Sequence 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVKT-1\ldots.....S-S \(\ldots \ldots+1\) KGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Research Production Process A PCR-amplified gene was cloned into a modified pET28a vector to express recombinant protein in \(E\). coli. Protein more than \(90 \%\) pure was obtained by affinity purification with Ni-nitrilotriacetic acid (NTA) beads followed by Resource Q column chromatography. In addition to the traditional process and host-cell-related impurities, the following substance related impurities are present in the process: Impurity 1: Des-Met (N-terminal methionine deleted for the desired protein) Impurity 2: C-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10) 1 ENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 43 APPACLPKATRKALGTVNRATEKSVK \(=1=\cdots \cdots\) TKGPLKQKQPSCFSAKKMTEKTCVKAKS 97 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 148 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Impurity 3: N-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10 ) 1 MATLIYVDK Impurity 4: Misfolded isoform 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVK- TKGPLKQKQPSCFSAKKMTEKTCVKAKS TKGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLM 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDE Impurity 5: Covalent dimer between cysteine 56 on adjacent molecules Information about chromatography adsorbents can be found through links to vari- ous companies at the textbook website (www.biosep.ou.edu). There is also a link to a spreadsheet to approximate protein charge as a function of pH at the textbook website.

Prediction of the Break-Point Time in Fixed-Bed Adsorption At low concentrations, the equilibrium for the antibiotic novobiocin and Dowex \(21 \mathrm{~K}\) anion exchange resin is linear, $$ q_{i}=125 c_{i}^{*} $$ for \(q_{i}\) and \(c_{i}^{*}\) in units of milligrams per milliliter. For the range of concentrations where this isotherm is valid, the mass transfer coefficient \(K_{a}\) averages \(82 \mathrm{~h}^{-1}\). Assuming a linear isotherm, estimate the break-point time (where \(c_{i} / c_{i 0}=0.05\) ) in a fixed-bed adsorber with a bed length of \(20 \mathrm{~cm}\) and superficial velocity of \(40 \mathrm{~cm} / \mathrm{h}\). (Data from P. A. Belter, F. L. Cunningham, and J. W. Chen, "Development of a recovery process for novobiocin," Biotechnol. Bioeng., vol. 15, p. 533,1973 .)

Removal of a Low-Level Contaminant One mode in which adsorbents are used is to strip a low-level contaminant like DNA from a product solution. No other solution components are negatively charged at the operating \(\mathrm{pH}\) for the column. (a) If an anion exchanger is used for this purpose, determine the total bed capacity for DNA given these parameters: bed volume \(=2\) liters, \(S_{\text {tot }}=2 \mathrm{mg} / \mathrm{ml}, K_{\text {eq }}=2 \mathrm{ml} / \mathrm{mg}\), and DNA concentration \(=5 \mu \mathrm{g} / \mathrm{ml}\). (b) Determine the bed capacity for the same conditions except that the DNA concentration is \(100 \mu \mathrm{g} / \mathrm{ml}\).

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.