/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Free solutions & answers for Bioseparations Science and Engineering Chapter 7 - (Page 1) [step by step] | 91Ó°ÊÓ

91Ó°ÊÓ

Problem 1

Freundlich versus Langmuir Isotherm Apply both the Freundlich isotherm and the Langmuir isotherm to the set of data shown in Table P7.1. Determine the applicable constants for the two different isotherms. Which is better, and why? TABLE P7.1 \begin{tabular}{ll} \(\mathbf{q}(\mathbf{m g} / \mathbf{g})\) & \(\mathbf{c}(\mathbf{m g} / \mathbf{m l})\) \\ \hline \(2.00 \times 10^{-2}\) & \(3.20 \times 10^{-9}\) \\ \(8.00 \times 10^{-2}\) & \(3.28 \times 10^{-6}\) \\ \(1.00 \times 10^{-1}\) & \(1.00 \times 10^{-5}\) \\ \(5.00 \times 10^{-1}\) & \(3.12 \times 10^{-2}\) \\ \(7.00 \times 10^{-1}\) & \(1.68 \times 10^{-1}\) \\ \(1.00\) & \(1.00\) \end{tabular}

Problem 2

Langmuir Isotherm For the Langmuir isotherm [Equation (7.2.6)], determine the relationship between the equilibrium constant \(K_{\text {eq }}\) and the mobile phase concentration [C] when the adsorbent is half saturated.

Problem 3

Three Binding Solutes Derive the isotherms for three binding solutes that all compete for the same sites on the resin. If \(K_{\text {eq2 }}>K_{\text {eq } 1}\) (c) \(c_{2}\) is low initially, and increases throughout the elution process.

Problem 5

Dispersion versus Molecular Diffusivity What is the difference between the effective dispersivity \(\mathscr{_}{\mathrm{eff}}\) and molecular diffusivity \(\odot_{\mathrm{m}}\) ? What are the units for each?

Problem 6

Prediction of the Break-Point Time in Fixed-Bed Adsorption At low concentrations, the equilibrium for the antibiotic novobiocin and Dowex \(21 \mathrm{~K}\) anion exchange resin is linear, $$ q_{i}=125 c_{i}^{*} $$ for \(q_{i}\) and \(c_{i}^{*}\) in units of milligrams per milliliter. For the range of concentrations where this isotherm is valid, the mass transfer coefficient \(K_{a}\) averages \(82 \mathrm{~h}^{-1}\). Assuming a linear isotherm, estimate the break-point time (where \(c_{i} / c_{i 0}=0.05\) ) in a fixed-bed adsorber with a bed length of \(20 \mathrm{~cm}\) and superficial velocity of \(40 \mathrm{~cm} / \mathrm{h}\). (Data from P. A. Belter, F. L. Cunningham, and J. W. Chen, "Development of a recovery process for novobiocin," Biotechnol. Bioeng., vol. 15, p. 533,1973 .)

Problem 10

Removal of a Low-Level Contaminant One mode in which adsorbents are used is to strip a low-level contaminant like DNA from a product solution. No other solution components are negatively charged at the operating \(\mathrm{pH}\) for the column. (a) If an anion exchanger is used for this purpose, determine the total bed capacity for DNA given these parameters: bed volume \(=2\) liters, \(S_{\text {tot }}=2 \mathrm{mg} / \mathrm{ml}, K_{\text {eq }}=2 \mathrm{ml} / \mathrm{mg}\), and DNA concentration \(=5 \mu \mathrm{g} / \mathrm{ml}\). (b) Determine the bed capacity for the same conditions except that the DNA concentration is \(100 \mu \mathrm{g} / \mathrm{ml}\).

Problem 11

Chromatography Scale-up It is desired to scale up the throughput by a factor of 150 for a linear gradient ion exchange chromatography of a product protein from the laboratory to the plant. The conditions for the laboratory chromatography are the following: \(1.0 \mathrm{~cm}\) bed diameter (ID) \(\times 20 \mathrm{~cm}\) bed height, \(20 \mu \mathrm{m}\) particle size, and \(30 \mathrm{~cm} / \mathrm{h}\) superficial velocity. The particle size of the same type of ion exchange resin available for the plant operation is \(40 \mu \mathrm{m}\). Two columns are available in the plant: one column \(14.0 \mathrm{~cm}\) diameter (ID) \(\times 50 \mathrm{~cm}\) high, and another column \(18.0 \mathrm{~cm}\) diameter (ID) \(\times 50 \mathrm{~cm}\) high. To keep the resolution for the chromatography constant in the plant, which column should be used? For this column, what should be the resin bed height and the superficial velocity and what do you estimate the pressure drop to be? The viscosity of the mobile phase is \(1.0 \mathrm{cp}\), and the void fraction for resin in the plant column is \(0.33\).

Problem 12

Design of a Protein Purification Process (Mini-Case Study) Propose a purification process for the protein described. Assume a bacterial process. Design of the process will involve estimation of protein properties, for which a spreadsheet is provided at the textbook website (http://www.biosep.ou.edu). (Protein adapted from H. Zou, T. J. McGarry, T. Bernal, and M. W. Kirschner, "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis," Science, vol. 285, pp. \(418-422,1999 .)\) Sequence 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVKT-1\ldots.....S-S \(\ldots \ldots+1\) KGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Research Production Process A PCR-amplified gene was cloned into a modified pET28a vector to express recombinant protein in \(E\). coli. Protein more than \(90 \%\) pure was obtained by affinity purification with Ni-nitrilotriacetic acid (NTA) beads followed by Resource Q column chromatography. In addition to the traditional process and host-cell-related impurities, the following substance related impurities are present in the process: Impurity 1: Des-Met (N-terminal methionine deleted for the desired protein) Impurity 2: C-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10) 1 ENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 43 APPACLPKATRKALGTVNRATEKSVK \(=1=\cdots \cdots\) TKGPLKQKQPSCFSAKKMTEKTCVKAKS 97 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 148 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Impurity 3: N-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10 ) 1 MATLIYVDK Impurity 4: Misfolded isoform 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVK- TKGPLKQKQPSCFSAKKMTEKTCVKAKS TKGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLM 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDE Impurity 5: Covalent dimer between cysteine 56 on adjacent molecules Information about chromatography adsorbents can be found through links to vari- ous companies at the textbook website (www.biosep.ou.edu). There is also a link to a spreadsheet to approximate protein charge as a function of pH at the textbook website.

Problem 13

Specification of Equipment for Chromatography Steps (Mini-Case Study) Use the purification steps selected in Problem 7.12, to choose equipment and specify column scale for the chromatography steps, given the following considerations: \- Fermentation titer: The \(E\). coli process produces 500 liters of product at a concentration of \(2.5 \mathrm{~g} / \mathrm{liter}\). One fermentation cycle is \(48 \mathrm{~h}\), and the success rate is \(90 \%\) (failure means that the entire fermentation batch had to be dumped); \(50 \%\) of the recovered protein is the target product. \- There will be a need for \(3000 \mathrm{~g}\) for clinical trial material for E. coli product, produced over three or more batches. \- There are 3 months available to campaign the clinical material, starting after the year end shutdown. \- Each purification step gives a yield of \(90 \%\), and there is an additional \(10 \%\) penalty every third step. \- The protein degrades with the following zero-order kinetics (independent of concentration): $$ \operatorname{rate}(\% / \text { day })=-50 e^{-1000 / T} \quad T \text { in } \mathrm{K} $$ The degradation product is a deamidation of asparagine 11 and must be purified away if it exceeds \(0.1 \%\). \begin{tabular}{lccc} Number of columns & Diameter \((\mathbf{c m})\) & Minimum/maximum length \((\mathbf{c m})\) & Maximum pressure (bar) \\ \hline 1 & 100 & \(5 / 20\) & 3 \\ 1 & 63 & \(7 / 30\) & 3 \\ 2 & 25 & \(12 / 50\) & 5 \\ 1 & 15 & \(30 / 100\) & 100 \end{tabular} \- One chromatography cycle takes \(6 \mathrm{~h}\) starting from storage or cleaning solutions, \(4.5 \mathrm{~h}\) when one is resuming from the elution step. \- A water for injection (WFI) still is available that produces \(200 \mathrm{liters} / \mathrm{h}\). \- There are two \(4^{\circ} \mathrm{C}\) cold rooms. \- Two crossflow filter housings are available, one capable of holding \(50 \mathrm{ft}^{2}\) of membrane, the other capable of holding \(200 \mathrm{ft}^{2}\). \- Any tank you size can be made available. Factors to Consider \- Compatibility with current processes (what's currently used in manufacturing?) \- Cleaning and storage requirements (ease of accommodation in the plant, handling issues, etc.) \- Preferred vendor (experience, reliability, delivery, price, validation package?) \- Future scalability

Problem 14

Specification of a Column for Protein Chromatography A protein chromatography column that processes \(15 \mathrm{~kg}\) of protein in \(60 \mathrm{~h}\), is cycled every \(6 \mathrm{~h}\), can be loaded with 10 grams of protein per liter of column volume, has a maximum flow rate of 50 liters/ min at a pressure of 4 bar, and is packed with an incompressible resin having a particle diameter of \(90 \mu \mathrm{m}\) and void fraction of \(0.35\). The viscosity can be assumed to be that of water. (a) What are the dimensions required for the column? (b) If the flow rate is 1 column volume per minute and the pressure rating is still 4 bar, what column dimensions are required? Is the resolution equivalent to that for part (a)? (c) If the pressure rating for the column were raised to 12 bar, should the column dimensions change? Is so, what should the dimensions be? Do they make sense? (d) What is the best way to increase the productivity of the column packing?

Access millions of textbook solutions in one place

  • Access over 3 million high quality textbook solutions
  • Access our popular flashcard, quiz, mock-exam and notes features
  • Access our smart AI features to upgrade your learning
Access millions of textbook solutions in one place

Recommended explanations on Chemistry Textbooks