/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 17 Chromatography of an Antibiotic ... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

Chromatography of an Antibiotic with a Freundlich Isotherm The antibiotic cephalosporin \(\mathrm{C}\) is being purified on a chromatography column packed with \(\mathrm{XAD}-2\) adsorbent beads. Adsorption experiments have shown that the equilibrium can be described by the following Freundlich isotherm: $$ q=1.99 c^{0.746} $$ for \(q\) and \(c\) in units of \(\mathrm{mg} / \mathrm{ml}\). For an injection concentration of \(0.5 \mathrm{mg} / \mathrm{ml}\) and elution superficial velocity of \(30 \mathrm{~cm} / \mathrm{h}\), determine the time for the shock wave front to exit a column that is \(50 \mathrm{~cm}\) long and has a void fraction of \(0.37\) (Data from N. F. Kirkby, N. K. H. Slater, K. H. Weisenberger, F. Addo-Yobo, and D. Doulia, "An HPLC technique for parameter estimation for reversed-phase chromatography: A case study on cephalosporin C," Chem. Eng. Sci., vol 41, p. 2005, 1986).

Short Answer

Expert verified
After the calculations, you will obtain the time it takes for the shock front to exit the column.

Step by step solution

01

Apply Freundlich isotherm

Substitute given concentration \(c = 0.5 \, \mathrm{mg}/\mathrm{ml}\) to the Freundlich isotherm equation \(q = 1.99 \, c^{0.746}\) to calculate the equilibrium adsorbate concentration on adsorbent.
02

Calculate Equilibrium Adsorption Capacity

After the substitution, the concentration \(q\) (in \(\mathrm{mg}/\mathrm{ml}\)) of the antibiotic on the adsorbent is obtained.
03

Calculate Time for the Shock Front

Using the value obtained from step 2, the superficial velocity of the elution and the length and void fraction of the column, you can calculate the time for the shock front to exit the column using the following relation: \[t = \frac{L}{u (\varepsilon + (1 - \varepsilon)q)}\] Where: \[t = \text{time}\]\[L = \text{length of the column} = 50 \, \mathrm{cm}\]\[u = \text{superficial velocity of elution} = 30 \, \mathrm{cm/h}\]\[\varepsilon = \text{void fraction} = 0.37\]\[q = \text{concentration obtained from step 2}\] Plug in these values to find the time for the shock wave front to exit the column. Remember to convert unit of time to appropriate one if necessary.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Freundlich Isotherm
The Freundlich Isotherm is an empirical equation that describes the adsorption characteristics of a solute on a porous adsorbent surface. The equation is represented as \( q = k \times c^n \), where \( q \) is the amount of solute adsorbed (mg/ml), \( c \) is the solute concentration in the solution (mg/ml), \( k \) and \( n \) are empirical constants specific to the adsorbent-solute pair.

In chromatography, the Freundlich Isotherm helps predict how a solute will interact with the stationary phase and can influence parameters such as retention time and separation efficiency. The non-linearity of the isotherm (\( n \) not equal to 1) suggests that the adsorption capacity changes as the concentration of the adsorbate changes, common in heterogeneous surfaces.
Adsorption Chromatography
Adsorption chromatography is a method where the stationary phase adsorbs the molecules to be separated based on their polarities and molecular structure. The technique relies on the differential adhesive forces between the mobile phase and the stationary phase.

In the process of cephalosporin purification, a column packed with \( \mathrm{XAD}-2 \) adsorbent beads is utilized. The adsorbent's surface properties will attract and bind the cephalosporin differently than impurities. The sample is introduced at the top of the column and migrates down, where desired substances are selectively adsorbed and later eluted. The characteristics of the adsorption process are often described by isotherms like the Freundlich Isotherm, giving insight into the interaction between the compounds and the adsorbent.
Cephalosporin Purification
Cephalosporins are a class of antibiotics that require careful purification processes to ensure their potency and safety. In the given scenario, cephalosporin \( \mathrm{C} \) is purified through adsorption chromatography utilizing a stationary phase of \( \mathrm{XAD}-2 \) adsorbent beads.

The purification process's effectiveness hinges on the adsorption capacity of the beads, which is determined using the Freundlich Isotherm equation. This allows for an accurate prediction of cephalosporin binding and the design of a chromatography process that ensures efficient purification by picking up the right concentration and flow rates. The said purification method is crucial in the pharmaceutical industry, where the purity of antibiotics plays a critical role in patient safety and treatment efficacy.
Shock Wave Front
In chromatography, a shock wave front refers to a sharp concentration change moving through the column. This phenomenon occurs when there is a sudden change in the mobile phase composition or solute concentration.

Within the context of cephalosporin purification, the shock wave front represents the leading boundary of highly concentrated solute moving through the column. Calculating the time for the shock wave front to exit gives valuable information regarding the elution profile and the effectiveness of the separation process. The formula \( t = \frac{L}{u (\varepsilon + (1 - \varepsilon)q)} \) used to determine the time for the shock front allows technicians to predict the outcome and make adjustments to the process in real-time, enhancing separation and purification quality.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

Dispersion versus Molecular Diffusivity What is the difference between the effective dispersivity \(\mathscr{_}{\mathrm{eff}}\) and molecular diffusivity \(\odot_{\mathrm{m}}\) ? What are the units for each?

Design of a Protein Purification Process (Mini-Case Study) Propose a purification process for the protein described. Assume a bacterial process. Design of the process will involve estimation of protein properties, for which a spreadsheet is provided at the textbook website (http://www.biosep.ou.edu). (Protein adapted from H. Zou, T. J. McGarry, T. Bernal, and M. W. Kirschner, "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis," Science, vol. 285, pp. \(418-422,1999 .)\) Sequence 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVKT-1\ldots.....S-S \(\ldots \ldots+1\) KGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Research Production Process A PCR-amplified gene was cloned into a modified pET28a vector to express recombinant protein in \(E\). coli. Protein more than \(90 \%\) pure was obtained by affinity purification with Ni-nitrilotriacetic acid (NTA) beads followed by Resource Q column chromatography. In addition to the traditional process and host-cell-related impurities, the following substance related impurities are present in the process: Impurity 1: Des-Met (N-terminal methionine deleted for the desired protein) Impurity 2: C-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10) 1 ENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 43 APPACLPKATRKALGTVNRATEKSVK \(=1=\cdots \cdots\) TKGPLKQKQPSCFSAKKMTEKTCVKAKS 97 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 148 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Impurity 3: N-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10 ) 1 MATLIYVDK Impurity 4: Misfolded isoform 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVK- TKGPLKQKQPSCFSAKKMTEKTCVKAKS TKGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLM 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDE Impurity 5: Covalent dimer between cysteine 56 on adjacent molecules Information about chromatography adsorbents can be found through links to vari- ous companies at the textbook website (www.biosep.ou.edu). There is also a link to a spreadsheet to approximate protein charge as a function of pH at the textbook website.

Three Binding Solutes Derive the isotherms for three binding solutes that all compete for the same sites on the resin. If \(K_{\text {eq2 }}>K_{\text {eq } 1}\) (c) \(c_{2}\) is low initially, and increases throughout the elution process.

Chromatography Scale-up-Pilot Plant to Plant You are designing a plant scale chromatography to purify a protein. You have pilot scale data with an adequate resolution. In this pilot data, the column has a cross-sectional area \(A_{I}\) and a bed height, \(L_{l}\). The pilot column data has it operating with a gradient going from \(c_{\text {low }, l}\) to \(c_{\text {hi, },}\), and a total gradient volume of \(V_{g .1} / V_{l}\) (in bed volumes). The pilot column is able to produce \(M_{l}\) grams of protein per cycle. You want to scale up the column to produce \(M_{2}\) grams of protein per cycle. You only have one large column available to use, with a cross-sectional area of \(A_{2}\). The maximum pressure drop allowed for the large column is \(\Delta p_{2}\). The particle diameter \(d_{p}\), column void fraction \(\varepsilon\), and solution viscosity \(\mu\) are the same at the pilot plan and plant scales. It is desired to operate the large column at flow rate \(Q_{2}\) at the same resolution as in the pilot scale column. The lower and upper concentrations of the gradient \(\left(c_{l o w}\right.\) and \(c_{h i}\) ) are different for the plant column. For the large column, develop expressions for the maximum allowable bed height and for the bed volumes of the gradient.

Prediction of the Break-Point Time in Fixed-Bed Adsorption At low concentrations, the equilibrium for the antibiotic novobiocin and Dowex \(21 \mathrm{~K}\) anion exchange resin is linear, $$ q_{i}=125 c_{i}^{*} $$ for \(q_{i}\) and \(c_{i}^{*}\) in units of milligrams per milliliter. For the range of concentrations where this isotherm is valid, the mass transfer coefficient \(K_{a}\) averages \(82 \mathrm{~h}^{-1}\). Assuming a linear isotherm, estimate the break-point time (where \(c_{i} / c_{i 0}=0.05\) ) in a fixed-bed adsorber with a bed length of \(20 \mathrm{~cm}\) and superficial velocity of \(40 \mathrm{~cm} / \mathrm{h}\). (Data from P. A. Belter, F. L. Cunningham, and J. W. Chen, "Development of a recovery process for novobiocin," Biotechnol. Bioeng., vol. 15, p. 533,1973 .)

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.