/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 11 Chromatography Scale-up It is de... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

Chromatography Scale-up It is desired to scale up the throughput by a factor of 150 for a linear gradient ion exchange chromatography of a product protein from the laboratory to the plant. The conditions for the laboratory chromatography are the following: \(1.0 \mathrm{~cm}\) bed diameter (ID) \(\times 20 \mathrm{~cm}\) bed height, \(20 \mu \mathrm{m}\) particle size, and \(30 \mathrm{~cm} / \mathrm{h}\) superficial velocity. The particle size of the same type of ion exchange resin available for the plant operation is \(40 \mu \mathrm{m}\). Two columns are available in the plant: one column \(14.0 \mathrm{~cm}\) diameter (ID) \(\times 50 \mathrm{~cm}\) high, and another column \(18.0 \mathrm{~cm}\) diameter (ID) \(\times 50 \mathrm{~cm}\) high. To keep the resolution for the chromatography constant in the plant, which column should be used? For this column, what should be the resin bed height and the superficial velocity and what do you estimate the pressure drop to be? The viscosity of the mobile phase is \(1.0 \mathrm{cp}\), and the void fraction for resin in the plant column is \(0.33\).

Short Answer

Expert verified
Based on the scale-up factor and maintaining resolution, the best column for the plant operation has a diameter of 18cm and a height of 10cm. The superficial velocity should be kept the same, at 30 cm/h. The estimated pressure drop across the chromatography bed is about 24.5 kg/cm^2.

Step by step solution

01

Determine Scale-Up Factor

First, we need to determine the scaling factor for linear gradient ion exchange chromatography. This is accomplished by using the given factor of 150.
02

Calculate Bed Diameter and Height for Scale-Up

The volume of the resin bed in the lab is given by \(\pi (d^2/4) h\), where \(d\) is the bed diameter and \(h\) is the bed height. Using this, we find the lab bed volume is \(\pi (1cm^2/4) * 20cm = 15.7 cm^3\). The plant bed volume is then \(15.7 cm^3 * 150 = 2355 cm^3\).
03

Determine Bed Dimensions for Plant Operation

We need to keep the particle size the same to maintain the resolution. The available plant particle size is twice of the lab particle size so we scale down the lab bed height by a factor of 2. So, bed height for the plant operation is 20cm / 2 = 10cm. For determining which of the given plant columns to use, we calculate the bed volume that each can hold and choose the one that is closest to the required volume. We pick the 18cm diameter column because its bed volume of \(\pi (18cm^2/4) * 10cm = 2544.6 cm^3\) is closest to the required 2355 cm^3.
04

Determine Required Superficial Velocity

The lab scale superficial velocity was 30 cm/h. Since the scale-up is linear, the plant scale superficial velocity would be the same, 30 cm/h.
05

Calculate Pressure Drop

The pressure drop in a packed bed can be calculated using Ergun's equation: \(\Delta p = 150 * (1 - \varepsilon)^2 (\mu * v) / (d_p * \varepsilon ^3) + 1.75 * (1 - \varepsilon) * v^2 * \rho / (d_p * \varepsilon ^3)\). Here, \(\varepsilon\) is the void fraction, \(\mu\) is the viscosity of the mobile phase, \(v\) is the superficial velocity, \(d_p\) is the particle diameter, and \(\rho\) is the fluid density (=1 for water). Since the second term is much less than the first, we approximate the pressure drop using only the first term. Substituting the given values, \(\Delta p = 150 * (1 - 0.33)^2 * (1.0 * 30/60) / (40 * 10^-4 * 0.33^3) = 24.5 kg/cm^2\). So, the pressure drop would be about 24.5 kg/cm^2.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Ion Exchange Chromatography
Ion exchange chromatography is a powerful separation technique used primarily for protein purification and other biological molecules. This method relies on the charge properties of molecules, where charged ions in the solution exchange with similarly charged ions attached to the resins on the chromatographic medium.
During this process, a sample is passed through a column packed with charged resin beads. Different molecules travel through the column at different speeds due to their distinct affinities towards the ionic groups on the resins. By altering the ionic composition of the mobile phase, the molecules can be selectively eluted from the column.
This method is central in scaling up laboratory procedures to industrial processes because it maintains the integrity of biomolecules while providing efficient separation. Understanding how to translate small-scale lab processes to larger scales requires careful attention to parameters like particle size and column dimensions to maintain resolution.
Packed Bed Pressure Drop
A carefully designed ion exchange column must consider the pressure drop, which is the resistance encountered by the fluid as it passes through the packed resin bed. The pressure drop across a column impacts both the flow rate and the efficiency of the separation process.
To calculate the pressure drop, one often uses Ergun's equation, which factors in the viscosity of the fluid, the flow velocity, and the particle size of the resin used. This comprehensive formula reflects how these variables affect the packed bed.
In our example, the pressure drop was approximated using the permeability factor of the resin, emphasizing the need for balance between pressure requirements and the physical constraints of upscaling. Although high pressures could enhance flow rates, excessive pressure may damage the column or alter the resin properties.
Particle Size Considerations
Particle size is a crucial factor in ion exchange chromatography, affecting both the resolution and the pressure drop within the column. Smaller particles generally provide higher resolution because they increase the surface area available for ion exchange, allowing for better separation of molecules.
However, using smaller particles often leads to a higher pressure drop because the fluid has to navigate through a denser packed bed. When scaling processes up, sometimes particle size is adjusted to balance between maintaining resolution and managing the pressure drop.
In our example, scaling was addressed by adopting a particle size that was doubled for the plant operation as compared to the lab. This theoretically helps maintain the separation efficiency while adjusting the column dimensions to manage the limitations imposed by higher throughput demands.
Superficial Velocity
Superficial velocity refers to the linear velocity of a fluid moving through a column as if the column were empty. In ion exchange chromatography, it is a critical parameter that influences both the speed and efficiency of the separation process.
This parameter helps define how quickly the mobile phase moves through the resin bed, affecting the interaction time between the sample and resin, thereby impacting resolution and separation quality.
In scale-up situations, maintaining the same superficial velocity as that of the lab scale can help keep the process linear and consistent. Consistency ensures that the separation process is predictable and manageable, which is why the lab's superficial velocity was mirrored in the plant's scaled-up operation.
Column Selection
Selecting the appropriate column for scale-up is pivotal for maintaining performance parameters such as resolution, capacity, and flow rate. This decision requires consideration of factors like column diameter, height, and volume to uphold the analytical characteristics obtained in the lab scale.
In the given problem, choosing the column with dimensions closest to the calculated bed volume ensures that the scaled-up process remains aligned with lab results.
  • A wider column allows for higher throughput, aligning the plant’s production with the increased demand.
  • The height must be adjusted considering changes in particle size, ensuring pressure and separation efficacy are preserved.
Ultimately, selecting the right column takes into account the interplay of all parameters while addressing the increased scale, ensuring the chromatography maintains efficiency and resolution across all phases.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

Design of a Protein Purification Process (Mini-Case Study) Propose a purification process for the protein described. Assume a bacterial process. Design of the process will involve estimation of protein properties, for which a spreadsheet is provided at the textbook website (http://www.biosep.ou.edu). (Protein adapted from H. Zou, T. J. McGarry, T. Bernal, and M. W. Kirschner, "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis," Science, vol. 285, pp. \(418-422,1999 .)\) Sequence 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVKT-1\ldots.....S-S \(\ldots \ldots+1\) KGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Research Production Process A PCR-amplified gene was cloned into a modified pET28a vector to express recombinant protein in \(E\). coli. Protein more than \(90 \%\) pure was obtained by affinity purification with Ni-nitrilotriacetic acid (NTA) beads followed by Resource Q column chromatography. In addition to the traditional process and host-cell-related impurities, the following substance related impurities are present in the process: Impurity 1: Des-Met (N-terminal methionine deleted for the desired protein) Impurity 2: C-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10) 1 ENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 43 APPACLPKATRKALGTVNRATEKSVK \(=1=\cdots \cdots\) TKGPLKQKQPSCFSAKKMTEKTCVKAKS 97 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 148 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Impurity 3: N-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10 ) 1 MATLIYVDK Impurity 4: Misfolded isoform 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVK- TKGPLKQKQPSCFSAKKMTEKTCVKAKS TKGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLM 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDE Impurity 5: Covalent dimer between cysteine 56 on adjacent molecules Information about chromatography adsorbents can be found through links to vari- ous companies at the textbook website (www.biosep.ou.edu). There is also a link to a spreadsheet to approximate protein charge as a function of pH at the textbook website.

Chromatography Scale-up-Pilot Plant to Plant You are designing a plant scale chromatography to purify a protein. You have pilot scale data with an adequate resolution. In this pilot data, the column has a cross-sectional area \(A_{I}\) and a bed height, \(L_{l}\). The pilot column data has it operating with a gradient going from \(c_{\text {low }, l}\) to \(c_{\text {hi, },}\), and a total gradient volume of \(V_{g .1} / V_{l}\) (in bed volumes). The pilot column is able to produce \(M_{l}\) grams of protein per cycle. You want to scale up the column to produce \(M_{2}\) grams of protein per cycle. You only have one large column available to use, with a cross-sectional area of \(A_{2}\). The maximum pressure drop allowed for the large column is \(\Delta p_{2}\). The particle diameter \(d_{p}\), column void fraction \(\varepsilon\), and solution viscosity \(\mu\) are the same at the pilot plan and plant scales. It is desired to operate the large column at flow rate \(Q_{2}\) at the same resolution as in the pilot scale column. The lower and upper concentrations of the gradient \(\left(c_{l o w}\right.\) and \(c_{h i}\) ) are different for the plant column. For the large column, develop expressions for the maximum allowable bed height and for the bed volumes of the gradient.

Estimation of the Number of Theoretical Plates for Ion Exchange Chromatography of a Protein Following a Langmuir Isotherm A \(20 \mathrm{~cm}\) long ion exchange column is loaded with a protein solution at a concentration of \(3 \mathrm{mg} / \mathrm{ml}\) and is eluted isocratically at a superficial velocity of \(30 \mathrm{~cm} / \mathrm{h}\). The void fraction is \(0.3\). The protein has a \(K_{\text {eq }}\) (Langmuir isotherm) of \(1.0 \mathrm{ml} / \mathrm{mg}\), and the column's resin is saturated with the protein at a resin-phase concentration of \(10 \mathrm{mg} / \mathrm{ml}\). If the protein peak has a standard deviation of \(4.0 \mathrm{~min}\), estimate the number of theoretical plates in the column.

Specification of a Column for Protein Chromatography A protein chromatography column that processes \(15 \mathrm{~kg}\) of protein in \(60 \mathrm{~h}\), is cycled every \(6 \mathrm{~h}\), can be loaded with 10 grams of protein per liter of column volume, has a maximum flow rate of 50 liters/ min at a pressure of 4 bar, and is packed with an incompressible resin having a particle diameter of \(90 \mu \mathrm{m}\) and void fraction of \(0.35\). The viscosity can be assumed to be that of water. (a) What are the dimensions required for the column? (b) If the flow rate is 1 column volume per minute and the pressure rating is still 4 bar, what column dimensions are required? Is the resolution equivalent to that for part (a)? (c) If the pressure rating for the column were raised to 12 bar, should the column dimensions change? Is so, what should the dimensions be? Do they make sense? (d) What is the best way to increase the productivity of the column packing?

Prediction of the Break-Point Time in Fixed-Bed Adsorption At low concentrations, the equilibrium for the antibiotic novobiocin and Dowex \(21 \mathrm{~K}\) anion exchange resin is linear, $$ q_{i}=125 c_{i}^{*} $$ for \(q_{i}\) and \(c_{i}^{*}\) in units of milligrams per milliliter. For the range of concentrations where this isotherm is valid, the mass transfer coefficient \(K_{a}\) averages \(82 \mathrm{~h}^{-1}\). Assuming a linear isotherm, estimate the break-point time (where \(c_{i} / c_{i 0}=0.05\) ) in a fixed-bed adsorber with a bed length of \(20 \mathrm{~cm}\) and superficial velocity of \(40 \mathrm{~cm} / \mathrm{h}\). (Data from P. A. Belter, F. L. Cunningham, and J. W. Chen, "Development of a recovery process for novobiocin," Biotechnol. Bioeng., vol. 15, p. 533,1973 .)

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.