/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 12 Design of a Protein Purification... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

Design of a Protein Purification Process (Mini-Case Study) Propose a purification process for the protein described. Assume a bacterial process. Design of the process will involve estimation of protein properties, for which a spreadsheet is provided at the textbook website (http://www.biosep.ou.edu). (Protein adapted from H. Zou, T. J. McGarry, T. Bernal, and M. W. Kirschner, "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis," Science, vol. 285, pp. \(418-422,1999 .)\) Sequence 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVKT-1\ldots.....S-S \(\ldots \ldots+1\) KGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Research Production Process A PCR-amplified gene was cloned into a modified pET28a vector to express recombinant protein in \(E\). coli. Protein more than \(90 \%\) pure was obtained by affinity purification with Ni-nitrilotriacetic acid (NTA) beads followed by Resource Q column chromatography. In addition to the traditional process and host-cell-related impurities, the following substance related impurities are present in the process: Impurity 1: Des-Met (N-terminal methionine deleted for the desired protein) Impurity 2: C-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10) 1 ENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 43 APPACLPKATRKALGTVNRATEKSVK \(=1=\cdots \cdots\) TKGPLKQKQPSCFSAKKMTEKTCVKAKS 97 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 148 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Impurity 3: N-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10 ) 1 MATLIYVDK Impurity 4: Misfolded isoform 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVK- TKGPLKQKQPSCFSAKKMTEKTCVKAKS TKGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLM 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDE Impurity 5: Covalent dimer between cysteine 56 on adjacent molecules Information about chromatography adsorbents can be found through links to vari- ous companies at the textbook website (www.biosep.ou.edu). There is also a link to a spreadsheet to approximate protein charge as a function of pH at the textbook website.

Short Answer

Expert verified
To purify the said protein, initially the protein's properties must be analyzed. Then already done purification using affinity chromatography should be performed. For removing smaller sized impurities, size exclusion chromatography (SEC) should be employed. The N-terminal cleavage product should be removed through cation exchange chromatography (CEC). Misfolded proteins and dimers can be removed using anion exchange chromatography (AEC). After these steps, do a final protein purification using affinity chromatography.

Step by step solution

01

Analyzing the Protein Properties

First, one must look into the protein’s properties - such as pI, charge, size, hydrophobicity, and the presence of specific functional groups (e.g. His-tag for Ni-NTA affinity) - and impurity profiles. These properties can be estimated based on the given protein sequence using appropriate software or a protein property spreadsheet mentioned in the exercise. Determining such properties will help to choose suitable chromatography and protein purification methods.
02

Initial Protein Purification

In the exercise, it is said that protein purification is already done using affinity chromatography. So the protein solution requires passing through Ni-NTA beads to bind His-tagged proteins, then the flowthrough (contains unbound proteins) must be collected. Washing the Ni-NTA beads will remove any weakly attached impurities.
03

Separating Impurities Based on Size

Next step should be size exclusion chromatography (SEC). Use this to separate impurities 1 and 2 from the desired protein because they are smaller in size. SEC works on the principle that smaller molecules enter the beads' pores and thus move slower through the column which separates large and small molecules.
04

Removing N-terminal cleavage product

Remove the N-terminal cleavage product (Impurity 3) using cation exchange chromatography (CEC). This method works on the charge-charge interactions between the proteins and the column material. Since the cleavage site is between a lysine (positive charge) and a glutamic acid (negative charge), the CEC binds proteins based on their net charge at the pH used. Adjust the pH so the N-terminal cleavage product is bound, but keep the desired protein unbound.
05

Removing Misfolded and Dimer Proteins

Impurities 4 and 5 can be removed by anion exchange chromatography (AEC). Adjust the pH so that the negatively charged misfolded proteins bind to the column, but keep the desired protein unbound. To collect unbound proteins, include a dialysis step to remove salts and other low molecular weight impurities.
06

Final Protein Purification

Lastly, repeat the affinity chromatography step to ensure complete removal of impurities. Then, validate the purity of the protein using methods like SDS-PAGE and Western Blotting. This will confirm the presence of the desired protein and absence of impurities.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Affinity Chromatography
Affinity chromatography is a powerful technique used to purify proteins based on a highly specific interaction between the protein of interest and a ligand attached to a chromatography matrix. For instance, a protein with a histidine tag (His-tag) will have a strong affinity for a column containing nickel-nitrilotriacetic acid (Ni-NTA). This specificity allows researchers to isolate the desired protein from a complex mixture.

During the purification process, the protein mixture is passed through the affinity column where the target protein binds to the ligand. Non-specifically bound proteins and other components can be washed away, and then the protein of interest can be eluted using a competitive ligand or by changing the conditions, such as the pH or ionic strength, to disrupt the interaction. This method is highly selective and can yield a high degree of protein purity after just one step.
Protein Properties Estimation
Estimating protein properties is a crucial step in designing a protein purification process. Properties such as isoelectric point (pI), molecular weight, hydrophobicity, and the presence of specific tags can be predicted using bioinformatics tools. These properties influence the choice of purification strategies.

For example, a protein's pI can determine the pH at which the protein will have a net neutral charge, which is valuable in ion exchange chromatography. The molecular weight is critical for size exclusion chromatography, where separation is based on the size of the protein. Protein property estimation tools and spreadsheets can quickly provide these insights from the provided amino acid sequence, facilitating the selection of suitable chromatography methods for purification.
Size Exclusion Chromatography
Size exclusion chromatography (SEC), also known as gel filtration chromatography, is a technique that separates molecules based on their size. In this technique, the chromatography column is packed with porous beads. Larger molecules cannot enter the pores of the beads and thus elute from the column first. Smaller molecules, on the other hand, enter the pores and have an effectively longer path to travel, eluting later.

The key to successful SEC is choosing the correct column material that can differentiate between the sizes of the desired protein and impurities. This method is gentle and can also be used for buffer exchange or desalting as it does not rely on harsh conditions that might denature the protein. SEC is an excellent choice for removing smaller molecular weight impurities from a protein solution, as seen in the example of removing Impurities 1 and 2 from the desired protein.
Cation Exchange Chromatography
Cation exchange chromatography (CEC) uses a negatively charged resin to bind positively charged molecules. The degree of interaction between the proteins and the resin depends on the net charge of the protein, which is influenced by the pH of the mobile phase. By adjusting the pH, one can manipulate the charge on proteins and elute them selectively.

In this type of chromatography, proteins with a net positive charge will bind to the negatively charged resin and can be eluted by increasing the salt concentration or altering the pH to reduce their net charge. This methodology is ideal for removing proteins or peptides with a net positive charge at the chosen pH, such as the N-terminal cleavage product (Impurity 3) which can be separated from the target protein if the conditions are optimized correctly.
Anion Exchange Chromatography
Anion exchange chromatography (AEC) works on a similar principle to CEC but reverses the charge interactions; here, a positively charged resin is used to bind negatively charged molecules. By controlling the pH, one can ensure that the desired protein remains unbound and passes through the column, while impurities with a higher net negative charge will bind to it.

Once the nonspecifically bound proteins are washed out, the bound impurities can then be eluted using a buffer with a high salt concentration, which shields the electrostatic interactions, or by altering the pH. This method is particularly useful in the latter stages of a purification protocol to remove negatively charged impurities, like the misfolded proteins or dimers (Impurities 4 and 5), ensuring a high degree of purity for the final protein product.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

Estimation of the Number of Theoretical Plates for Ion Exchange Chromatography of a Protein Following a Langmuir Isotherm A \(20 \mathrm{~cm}\) long ion exchange column is loaded with a protein solution at a concentration of \(3 \mathrm{mg} / \mathrm{ml}\) and is eluted isocratically at a superficial velocity of \(30 \mathrm{~cm} / \mathrm{h}\). The void fraction is \(0.3\). The protein has a \(K_{\text {eq }}\) (Langmuir isotherm) of \(1.0 \mathrm{ml} / \mathrm{mg}\), and the column's resin is saturated with the protein at a resin-phase concentration of \(10 \mathrm{mg} / \mathrm{ml}\). If the protein peak has a standard deviation of \(4.0 \mathrm{~min}\), estimate the number of theoretical plates in the column.

Freundlich versus Langmuir Isotherm Apply both the Freundlich isotherm and the Langmuir isotherm to the set of data shown in Table P7.1. Determine the applicable constants for the two different isotherms. Which is better, and why? TABLE P7.1 \begin{tabular}{ll} \(\mathbf{q}(\mathbf{m g} / \mathbf{g})\) & \(\mathbf{c}(\mathbf{m g} / \mathbf{m l})\) \\ \hline \(2.00 \times 10^{-2}\) & \(3.20 \times 10^{-9}\) \\ \(8.00 \times 10^{-2}\) & \(3.28 \times 10^{-6}\) \\ \(1.00 \times 10^{-1}\) & \(1.00 \times 10^{-5}\) \\ \(5.00 \times 10^{-1}\) & \(3.12 \times 10^{-2}\) \\ \(7.00 \times 10^{-1}\) & \(1.68 \times 10^{-1}\) \\ \(1.00\) & \(1.00\) \end{tabular}

Chromatographic Separation of a Protein A protein is being separated on a chromatography column. The protein has been found to obey the Langmuir isotherm, with \(S_{\text {lot }}=300 \mu \mathrm{g} / \mathrm{ml}\) and \(K_{\text {eq }}=10 \mathrm{ml} / \mathrm{mg}\). The concentration of the protein in the feed ( 3 liters) to the column is \(2 \mathrm{mg} / \mathrm{ml}\). The column flow rate is \(2.0\) liters/min. The column is \(50 \mathrm{~cm}\) in diameter and \(100 \mathrm{~cm}\) long. The void fraction of the chromatography bed is \(0.35 .\) Determine (a) the time for the protein shock front to exit the column, and (b) the time when the concentration of the protein in the diffuse wave is \(0.01 \mathrm{mg} / \mathrm{ml}\) at the exit of the column.

Chromatography Scale-up It is desired to scale up the throughput by a factor of 150 for a linear gradient ion exchange chromatography of a product protein from the laboratory to the plant. The conditions for the laboratory chromatography are the following: \(1.0 \mathrm{~cm}\) bed diameter (ID) \(\times 20 \mathrm{~cm}\) bed height, \(20 \mu \mathrm{m}\) particle size, and \(30 \mathrm{~cm} / \mathrm{h}\) superficial velocity. The particle size of the same type of ion exchange resin available for the plant operation is \(40 \mu \mathrm{m}\). Two columns are available in the plant: one column \(14.0 \mathrm{~cm}\) diameter (ID) \(\times 50 \mathrm{~cm}\) high, and another column \(18.0 \mathrm{~cm}\) diameter (ID) \(\times 50 \mathrm{~cm}\) high. To keep the resolution for the chromatography constant in the plant, which column should be used? For this column, what should be the resin bed height and the superficial velocity and what do you estimate the pressure drop to be? The viscosity of the mobile phase is \(1.0 \mathrm{cp}\), and the void fraction for resin in the plant column is \(0.33\).

Langmuir Isotherm For the Langmuir isotherm [Equation (7.2.6)], determine the relationship between the equilibrium constant \(K_{\text {eq }}\) and the mobile phase concentration [C] when the adsorbent is half saturated.

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.