/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 18 Chromatography Scale-up-Pilot Pl... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

Chromatography Scale-up-Pilot Plant to Plant You are designing a plant scale chromatography to purify a protein. You have pilot scale data with an adequate resolution. In this pilot data, the column has a cross-sectional area \(A_{I}\) and a bed height, \(L_{l}\). The pilot column data has it operating with a gradient going from \(c_{\text {low }, l}\) to \(c_{\text {hi, },}\), and a total gradient volume of \(V_{g .1} / V_{l}\) (in bed volumes). The pilot column is able to produce \(M_{l}\) grams of protein per cycle. You want to scale up the column to produce \(M_{2}\) grams of protein per cycle. You only have one large column available to use, with a cross-sectional area of \(A_{2}\). The maximum pressure drop allowed for the large column is \(\Delta p_{2}\). The particle diameter \(d_{p}\), column void fraction \(\varepsilon\), and solution viscosity \(\mu\) are the same at the pilot plan and plant scales. It is desired to operate the large column at flow rate \(Q_{2}\) at the same resolution as in the pilot scale column. The lower and upper concentrations of the gradient \(\left(c_{l o w}\right.\) and \(c_{h i}\) ) are different for the plant column. For the large column, develop expressions for the maximum allowable bed height and for the bed volumes of the gradient.

Short Answer

Expert verified
The maximum allowable bed height for the large column is given by \(L_{2}=\Delta p_{2} / (\Delta p_{I} / L_{I})\) and the bed volumes of the gradient for the large column is given by \(V_{g .2} = f \cdot V_{g .1}\), where \(f\) is the scaling factor calculated as \(M_{2} / M_{l}\).

Step by step solution

01

Determine Parameters Equality

Start by noting that, as specified in the exercise, certain parameters are the same at both the pilot and plant scales. These include the particle diameter \(d_{p}\), the column void fraction \(\varepsilon\), and the solution viscosity \(\mu\). This means that these quantities do not need to be adjusted when scaling up.
02

Calculate Scaling Factor

Next, calculate the scaling factor. This is the necessary increase in column scale to achieve the production target. It can be done by dividing the desired amount of protein per cycle at the large scale \(M_{2}\) by the amount produced per cycle at the pilot scale \(M_{l}\). Thus, the scaling factor \(f = M_{2} / M_{l}\).
03

Calculate Large Column Cross-Sectional Area

Afterwards, calculate for the large column's cross-sectional area. As the scaling up is going on, column cross-sectional area increases by the square root of the scaling factor. Hence, \(A_{2}= A_{I} \sqrt{f}\).
04

Calculate Maximum Bed Height

Now, calculate for the maximum allowable bed height at plant scale. The maximum pressure drop allowed in the large column depends on the maximum bed height. Use the relationship that pressure drop is proportional to bed height. Hence, \(L_{2}=\Delta p_{2} / (\Delta p_{I} / L_{I})\).
05

Calculate Bed Volumes of the Gradient

Finally, calculate for the bed volumes of the gradient at plant scale. The bed volume of the gradient at plant scale would be the bed volume of gradient at pilot scale times the scaling factor. Hence, \(V_{g .2} = f \cdot V_{g .1}\)

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Protein Purification
Protein purification is an essential process in biotechnology to isolate a single type of protein from a complex mixture. This is crucial for applications in research, pharmaceuticals, and diagnostics.
During purification, proteins are separated based on differences in their properties, such as size, charge, hydrophobicity, or binding affinity.
  • One of the popular methods for protein purification is chromatography.
  • Here, a mixture is passed through a medium where components travel at different speeds leading to separation of proteins.
  • Proteins of interest are then isolated through precise and carefully controlled conditions in the chromatography column.
Effective protein purification requires detailed knowledge of the proteins involved as well as familiarity with the chosen method, ensuring minimal loss of activity and structural integrity. When designing a scale-up for purification, like in the context of this exercise, it's key to maintain the same resolution achieved at smaller scales.
Column Parameters
When scaling up chromatography processes, understanding column parameters is vital for successful protein purification. Columns have specific features that determine their effectiveness in separating desired molecules.
  • Key parameters include cross-sectional area and bed height.
  • The cross-sectional area influences how much sample can be processed at once.
  • Bed height impacts separation quality and resolution due to the time analytes spend interacting with the column.
The exercise discusses how these parameters influence scaling up from a pilot to a larger plant scale. Keeping particle diameter, column void fraction, and solution viscosity consistent helps in making predictive adjustments. It's important to adapt column parameters effectively to avoid compromising the purification quality.
Flow Rate Resolution
In chromatography, flow rate is a crucial aspect that affects the resolution of separation. Flow rate refers to how quickly the liquid phase moves through the column.
In the scale-up process, maintaining an appropriate flow rate ensures that the resolution achieved in smaller scales remains unchanged in larger operations.
  • Increasing the flow rate can decrease interaction time between the analyte and stationary phase.
  • However, very high flow rates might reduce the column's ability to differentiate between closely eluting substances.
  • Lower flow rates allow better separation but take more time and can impact productivity.
The goal during scale-up is to preserve efficiency by adjusting the flow rate according to the column size and characteristics, as highlighted in the exercise.
Pressure Drop Considerations
Pressure drop is an important factor in column chromatography, especially during scale-up. It refers to the reduction in pressure as the fluid flows through the column, which can affect both the efficacy and safety of the operation.
  • Pressure drop is directly proportional to bed height and inversely proportional to particle size and column diameter.
  • Excessive pressure can damage the column or influence flow rate consistency.
  • During scale-up, the column must be designed to withstand pressures that ensure both optimal performance and longevity of the equipment.
The exercise directs attention to calculating maximum allowable bed height by considering pressure drop implications. For successful scale-up, maintaining allowable pressure drop ensures mechanical integrity and operational efficiency of larger columns.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Most popular questions from this chapter

Removal of a Low-Level Contaminant One mode in which adsorbents are used is to strip a low-level contaminant like DNA from a product solution. No other solution components are negatively charged at the operating \(\mathrm{pH}\) for the column. (a) If an anion exchanger is used for this purpose, determine the total bed capacity for DNA given these parameters: bed volume \(=2\) liters, \(S_{\text {tot }}=2 \mathrm{mg} / \mathrm{ml}, K_{\text {eq }}=2 \mathrm{ml} / \mathrm{mg}\), and DNA concentration \(=5 \mu \mathrm{g} / \mathrm{ml}\). (b) Determine the bed capacity for the same conditions except that the DNA concentration is \(100 \mu \mathrm{g} / \mathrm{ml}\).

Design of a Protein Purification Process (Mini-Case Study) Propose a purification process for the protein described. Assume a bacterial process. Design of the process will involve estimation of protein properties, for which a spreadsheet is provided at the textbook website (http://www.biosep.ou.edu). (Protein adapted from H. Zou, T. J. McGarry, T. Bernal, and M. W. Kirschner, "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis," Science, vol. 285, pp. \(418-422,1999 .)\) Sequence 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVKT-1\ldots.....S-S \(\ldots \ldots+1\) KGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Research Production Process A PCR-amplified gene was cloned into a modified pET28a vector to express recombinant protein in \(E\). coli. Protein more than \(90 \%\) pure was obtained by affinity purification with Ni-nitrilotriacetic acid (NTA) beads followed by Resource Q column chromatography. In addition to the traditional process and host-cell-related impurities, the following substance related impurities are present in the process: Impurity 1: Des-Met (N-terminal methionine deleted for the desired protein) Impurity 2: C-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10) 1 ENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 43 APPACLPKATRKALGTVNRATEKSVK \(=1=\cdots \cdots\) TKGPLKQKQPSCFSAKKMTEKTCVKAKS 97 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEER 148 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI Impurity 3: N-terminal cleavage product (cleavage between lysine 9 and glutamic acid 10 ) 1 MATLIYVDK Impurity 4: Misfolded isoform 1 MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD 52 APPACLPKATRKALGTVNRATEKSVK- TKGPLKQKQPSCFSAKKMTEKTCVKAKS TKGPLKQKQPSCFSAKKMTEKTCVKAKS 106 SVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLM 157 ELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDE Impurity 5: Covalent dimer between cysteine 56 on adjacent molecules Information about chromatography adsorbents can be found through links to vari- ous companies at the textbook website (www.biosep.ou.edu). There is also a link to a spreadsheet to approximate protein charge as a function of pH at the textbook website.

Three Binding Solutes Derive the isotherms for three binding solutes that all compete for the same sites on the resin. If \(K_{\text {eq2 }}>K_{\text {eq } 1}\) (c) \(c_{2}\) is low initially, and increases throughout the elution process.

Dispersion versus Molecular Diffusivity What is the difference between the effective dispersivity \(\mathscr{_}{\mathrm{eff}}\) and molecular diffusivity \(\odot_{\mathrm{m}}\) ? What are the units for each?

Specification of a Column for Protein Chromatography A protein chromatography column that processes \(15 \mathrm{~kg}\) of protein in \(60 \mathrm{~h}\), is cycled every \(6 \mathrm{~h}\), can be loaded with 10 grams of protein per liter of column volume, has a maximum flow rate of 50 liters/ min at a pressure of 4 bar, and is packed with an incompressible resin having a particle diameter of \(90 \mu \mathrm{m}\) and void fraction of \(0.35\). The viscosity can be assumed to be that of water. (a) What are the dimensions required for the column? (b) If the flow rate is 1 column volume per minute and the pressure rating is still 4 bar, what column dimensions are required? Is the resolution equivalent to that for part (a)? (c) If the pressure rating for the column were raised to 12 bar, should the column dimensions change? Is so, what should the dimensions be? Do they make sense? (d) What is the best way to increase the productivity of the column packing?

See all solutions

Recommended explanations on Chemistry Textbooks

View all explanations

What do you think about this solution?

We value your feedback to improve our textbook solutions.

Study anywhere. Anytime. Across all devices.