/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Free solutions & answers for Organic Chemistry Chapter 25 - (Page 2) [step by step] | 91Ó°ÊÓ

91Ó°ÊÓ

Problem 21

Starting with phenylalanine and glycine, outline the steps in the preparation of Phe-Gly by the Merrifield method.

Problem 26

What is the structure of oxaloacetic acid?

Problem 27

Which two \(\alpha\) -amino acids are the biosynthetic precursors of the penicillins?

Problem 28

\(\alpha\)-Amino acids are not the only compounds that exist as zwitterions. \(p\) -Aminobenzenesulfonic acid (sulfanilic acid) is normally written in the form shown but its zwitterionic form is more stable. Write a structural formula for the zwitterion.

Problem 30

Acrylonitrile \(\left(\mathrm{H}_{2} \mathrm{C} \square \mathrm{CHC} \square \mathrm{N}\right)\) readily undergoes conjugate addition when treated with nucleophilic reagents. Describe a synthesis of \(\beta\) -alanine \(\left(\mathrm{H}_{3} \mathrm{~N}^{+} \mathrm{CH}_{2} \mathrm{CH}_{2} \mathrm{CO}_{2}\right)\) that takes advantage of this fact.

Problem 36

Automated amino acid analysis of peptides containing asparagine (Asn) and glutamine (Gln) residues gives a peak corresponding to ammonia. Why?

Problem 39

The first 32 amino acids from the \(\mathrm{N}\) terminus of the protein bovine angiogenin were determined by Edman degradation and have the sequence. AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK (a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein. (b) What are the cleavage sites using chymotrypsin?

Problem 40

Somatostatin is a tetradecapeptide of the hypothalamus that inhibits the release of pituitary growth hormone. Its amino acid sequence has been determined by a combination of Edman degradations and enzymic hydrolysis experiments. On the basis of the following data, deduce the primary structure of somatostatin: 1\. Edman degradation gave PTH-Ala 2\. Selective hydrolysis gave peptides having the following indicated sequences: Phe-Trp Thr-Ser-Cys Lys-Thr-Phe Thr-Phe-Thr-Ser-Cys Asn-Phe-Phe-Trp-Lys Ala-Gly-Cys-Lys-Asn-Phe 3\. Somatostatin has a disulfide bridge

Problem 41

If you synthesized the tripeptide Leu-Phe-Ser from amino acids prepared by the Strecker synthesis, how many stereoisomers would you expect to be formed?

Problem 43

Native chemical ligation (NCL) is a method for coupling peptide chains. It requires that one of the peptides has an N-terminal cysteine, and that the \(\mathrm{C}\) terminus of the other peptide be a thioester. The thiol of the N-terminal cysteine of peptide 2 reacts with the thioester of peptide 1 to give an initial product that contains a "nonnative" thioester linkage. The initial product rearranges to a more stable, amide-linked (native) peptide. Write mechanisms for the coupling and rearrangement steps in NCL.

Access millions of textbook solutions in one place

  • Access over 3 million high quality textbook solutions
  • Access our popular flashcard, quiz, mock-exam and notes features
  • Access our smart AI features to upgrade your learning
Access millions of textbook solutions in one place

Recommended explanations on Chemistry Textbooks