/*! This file is auto-generated */ .wp-block-button__link{color:#fff;background-color:#32373c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em + 2px) calc(1.333em + 2px);font-size:1.125em}.wp-block-file__button{background:#32373c;color:#fff;text-decoration:none} Problem 39 The first 32 amino acids from th... [FREE SOLUTION] | 91Ó°ÊÓ

91Ó°ÊÓ

The first 32 amino acids from the \(\mathrm{N}\) terminus of the protein bovine angiogenin were determined by Edman degradation and have the sequence. AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK (a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein. (b) What are the cleavage sites using chymotrypsin?

Short Answer

Expert verified
(a) Trypsin cleaves at K and R: AQDDYRYIHFL, LTQHYDAK, PK, GR, NDEYCFNMMK. (b) Chymotrypsin cleaves at F and Y: AQDDY, RY, IHF, LTQHY, DAKPKGRNDEY, CFNMMK.

Step by step solution

01

Understand Trypsin Cleavage Site

Trypsin cleaves proteins at the carboxyl side of lysine (\( K \)) and arginine (\( R \)) residues. In the sequence AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK, identify the \( K \) and \( R \) residues where trypsin would cut.
02

Identify Trypsin Cleavage Points

Inspect the sequence for lysine \( K \) and arginine \( R \) residues: AQDD\( YRYIHF \)LTQHYDA\( K \)PKG\( R \)NDEYCFNMM\( K \). The cleavage occurs after residues \( K (lysine) \) and \( R (arginine) \).
03

Cleavage by Trypsin

The sequence is cleaved into peptide fragments after each \( K \) and \( R \) residue, resulting in: AQDD\( YRYIHF \), LTQHYDA\( K \), \( P \)K, G\( R \), NDEYCFNMM\( K \).
04

Understand Chymotrypsin Cleavage Site

Chymotrypsin cleaves at the carboxyl side of aromatic amino acids such as phenylalanine (\( F \)), tryptophan (\( W \)), and tyrosine (\( Y \)). Identify these residues in the sequence AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK.
05

Identify Chymotrypsin Cleavage Points

Inspect the sequence for phenylalanine \( F \), tryptophan \( W \), and tyrosine \( Y \) residues: AQDD\( Y \), R\( Y \), IH\( F \)LTQH\( Y \)DAKPKGRNDE\( Y \)CFNMMK. These are the cleavage points for chymotrypsin.
06

Cleavage by Chymotrypsin

The sequence is cleaved into peptide fragments after each \( F, W, \) and \( Y \) residue, resulting in: AQDD\( Y \), R\( Y \), IH\( F \), LTQH\( Y \), DAKPKGRNDE\( Y \), CFNMMK.

Unlock Step-by-Step Solutions & Ace Your Exams!

  • Full Textbook Solutions

    Get detailed explanations and key concepts

  • Unlimited Al creation

    Al flashcards, explanations, exams and more...

  • Ads-free access

    To over 500 millions flashcards

  • Money-back guarantee

    We refund you if you fail your exam.

Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!

Key Concepts

These are the key concepts you need to understand to accurately answer the question.

Amino Acid Sequence
Amino acid sequences are the building blocks of proteins. Proteins are made up of long chains of amino acids linked together by peptide bonds. Each amino acid has a specific side chain that gives it unique properties and determines how it interacts with other molecules. In protein science, understanding the order of these amino acids, or the amino acid sequence, is crucial. It allows scientists to determine how a protein might fold, its potential functions, and how it might interact with other molecules. In the given exercise, we have a sequence from bovine angiogenin which is 32 amino acids long. This sequence: AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK, gives us insights into where cleavage by specific enzymes might occur, demonstrating the sequence-dependent nature of protein cleavage.
Trypsin Cleavage
Trypsin is a proteolytic enzyme that specifically cleaves proteins at the carboxyl side of the amino acids lysine (K) and arginine (R). This specificity allows trypsin to be a useful tool in protein sequencing and analysis. During the trypsin-catalyzed reaction, the enzyme identifies these amino acids within a sequence, essentially cutting the protein into smaller fragments. - For instance, in the provided sequence, identify all the K and R residues: AQDDYRYIHFLTQHYDAK**PK**GR**NDEYCFNMM**K**. - This means trypsin will cleave the sequence into smaller peptides after each K and R, resulting in multiple fragments. This characteristic of trypsin is particularly useful in proteomics, where analyzing the fragments generated by trypsin cleavage can reveal much about the protein's structure and function.
Chymotrypsin Cleavage
Chymotrypsin is another type of proteolytic enzyme used in protein digestion and analysis. Unlike trypsin, chymotrypsin targets the amino acids with aromatic side chains such as phenylalanine (F), tryptophan (W), and tyrosine (Y). These residues have bulky, hydrophobic side chains that fit well into the enzyme's active site. - In the sequence AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK, identify the cleavage targets: AQDD**Y**, R**Y**, IH**F**LTQH**Y**DAKPKGRNDE**Y**CFNMMK. - Chymotrypsin will cleave the sequence at the carboxyl side of each of these residues, breaking the protein down into fragments. This enzymatic specificity makes chymotrypsin very useful in techniques like mass spectrometry for determining protein structures and examining complex protein mixtures.
Edman Degradation
Edman degradation is a method used to determine the amino acid sequence of a protein. This technique involves sequentially removing one residue at a time from the \( ext{N}\) terminus of a protein or peptide. The residue is then identified using chromatography. Although more modern techniques, like mass spectrometry, have largely replaced Edman degradation, it's still relevant for sequencing smaller peptides and proteins. The accuracy with which it can determine the amino acid sequence is one of its strongest points.- In the exercise, Edman degradation was used to determine the first 32 amino acids of bovine angiogenin, yielding the sequence: AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK.- This traditional method of sequencing highlights the importance of understanding the sequence from the \( ext{N}\) terminus, enabling scientists to infer the overall structure and function of the protein.
Proteolytic Enzymes
Proteolytic enzymes, also known as proteases, play a critical role in protein digestion and the breakdown of proteins into peptides and amino acids. These enzymes cleave the peptide bonds between amino acids, facilitating various biological processes. Among proteolytic enzymes, trypsin and chymotrypsin are well-known for their high specificity and are extensively used in biochemical research. - Trypsin targets residues like lysine and arginine, as seen in its action in the provided sequence. - Chymotrypsin, on the other hand, works on aromatic residues like tyrosine, phenylalanine, and tryptophan, showing its flexibility in different sequences. - The precision of these enzymes makes them indispensable tools in experiments aimed at studying protein structure, function, and interactions.

One App. One Place for Learning.

All the tools & learning materials you need for study success - in one app.

Get started for free

Study anywhere. Anytime. Across all devices.