Chapter 7: Problem 56
Solve. If \(f(t)=7+\sqrt{2 t-5}\) and \(g(t)=3(t+1)^{1 / 2}\) find any \(t\) for which \(f(t)=g(t)\)
Short Answer
Expert verified
t = 6.532
Step by step solution
01
- Set the Functions Equal
We start by setting the two given functions equal to each other, since we want to find the value of t for which they are the same.ewlineewlineewlineewline\(f(t) = g(t)\)ewlineewlineewlineewline\(7+\sqrt{2t-5} = 3( t+1 )^{1/2}\)
02
- Isolate the Square Roots
Isolate the square roots on one side to simplify the equation further.ewlineewlineewlineewline\(\sqrt{2t - 5} = 3\sqrt{t + 1} - 7\)
03
- Eliminate the Square Roots by Squaring Both Sides
Square both sides to eliminate the square roots. Be careful about properly expanding both sides.ewlineewlineewlineewline\((\sqrt{2t - 5})^2 = (3\sqrt{t + 1} - 7)^2\)ewlineewlineewlineewline\(2t - 5 = 9(t + 1) - 42\sqrt{t + 1} + 49\)
04
- Simplify and Rearrange
Expand and rearrange the equation to isolate the square root term again, so that we can square both sides once more if necessary.ewlineewlineewlineewline\(2t - 5 = 9t + 9 - 42\sqrt{t + 1} + 49\)ewlineewlineewlineewline\(-7t - 63 + 44 = -42\sqrt{t + 1}\)ewlineewlineewlineewline\(-7t - 19 = -42\sqrt{t + 1}\)
05
- Isolate the Square Root Term Again
Simplify by moving terms to the appropriate side and then solve for the square root term.ewlineewlineewlineewline\(\sqrt{t+1} = \frac{7t+19}{42}\)
06
- Square Both Sides Again
Square both sides of the equation to remove the square root and obtain a polynomial equation.ewlineewlineewlineewline\((\sqrt{t+1})^2 = \(\frac{7t+19}{42}\)^2\)ewlineewlineewlineewline\(t + 1 = \(\frac{49t^2 + 266t + 361}{1764}\)\)
07
- Clear the Fraction
Multiply both sides by 1764 to clear the fraction and simplify.ewlineewlineewlineewline\(1764(t + 1) = 49t^2 + 266t + 361\)
08
- Solve the Quadratic Equation
Rearrange the terms to set the equation to 0 and solve the quadratic equation using factoring, the quadratic formula, or another method.ewlineewlineewlineewline\(49t^2 + 266t + 361 - 1764t - 1764 = 0\)ewlineewlineewlineewline\(49t^2 - 1498t - 1403 = 0\)ewlineewlineewlineewlineApply the quadratic formula:ewlineewline\(t = \frac{-b \pm \sqrt{b^2 - 4ac}}{2a}\)
09
- Determine the Roots
After calculating, you will find the possible values for t:ewlineewlineewlineewline\(t = \frac{-266 \pm \sqrt{853444}}{98}\)ewlineewlineCalculate the discriminant:ewlineewline\(\sqrt{823476} = 905.2)\)ewlineewline\(t = \frac{-266 \pm 905.2}{98}\)
10
- Simplify Possible Solutions
Calculate the roots:ewlineewlineewlineewline\(t = \frac{-266 + 905.2}{98},\ \frac{-266 - 905.2}{98}\)ewlineState the final solutions clearlyewlineewlineewlineewline\(t = 6.532, -11.96\)
11
- Check Solutions for Validity
Check that these solutions satisfy the original problem. Usually, only positive values are meaningful for real problems, or by checking domain and range requirements.ewlineewlineewlineewline\(t = 6.532\)
Unlock Step-by-Step Solutions & Ace Your Exams!
-
Full Textbook Solutions
Get detailed explanations and key concepts
-
Unlimited Al creation
Al flashcards, explanations, exams and more...
-
Ads-free access
To over 500 millions flashcards
-
Money-back guarantee
We refund you if you fail your exam.
Over 30 million students worldwide already upgrade their learning with 91Ó°ÊÓ!
Key Concepts
These are the key concepts you need to understand to accurately answer the question.
Square Roots
Square roots are fundamental in solving many equations, especially those involving radical expressions. A square root of a number x is a number y such that \(y^2 = x\). For example, the square root of 9 is 3 because \(3^2 = 9\). Notably, square roots have both positive and negative solutions (e.g., \(\root 9 = \pm 3\)), but we often consider only the principal, or positive, square root in many problems. When working with square roots in equations, it often becomes essential to isolate the square root term to simplify the equation and then eliminate it by squaring both sides. This technique is crucial in solving the exercise given.
Quadratic Formula
The quadratic formula is used to find the roots of any quadratic equation of the form \(ax^2 + bx + c = 0\). The formula is \( x = \frac{-b \pm \sqrt{b^2 - 4ac}}{2a} \). Here, a, b, and c are coefficients from the quadratic equation, and the symbol \( \pm \) indicates that there will be two solutions—one using the positive square root and one using the negative. This formula is particularly useful when factoring is difficult or impossible. In our exercise, once we have simplified the equation to a quadratic form, we use the quadratic formula to solve for t.
Function Equality
Function equality means that two functions produce the same output for the same input. To solve for t in the given exercise, we set \(f(t)\) equal to \(g(t)\) since we want the t-value where both functions are equal. This sets up our initial equation \(7 + \sqrt{2t - 5} = 3\sqrt{t + 1}\). Solving for t involves manipulating this equation such that all terms related to t are isolated, and the radicals are removed by squaring both sides of the equation. This process of setting the functions equal and isolating terms is key for finding the common inputs of the two functions.
Polynomial Equations
Polynomial equations involve expressions composed of variables and coefficients using addition, subtraction, multiplication, and non-negative integer exponents. In the context of our exercise, after eliminating the square roots by squaring both sides, we end up with a polynomial equation in standard quadratic form. Simplifying and rearranging the terms \(t + 1 = \frac{49t^2 + 266t + 361}{1764} \) allows us to apply the quadratic formula. Solving polynomial equations is essential in various areas of mathematics, from basic algebra to advanced calculus.